Protein Family IF09565
Metagenome
Isolate
326
Members
93
Samples
280
Scaffolds
314.1
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_039419|Ga0466709_039419_57955_58983
- Length
- 342 aa
- Sequence
- MNKIGKNDESCTIKSPSGDLGSEVLTTTDYHFPEQTHVYHGKVRDVYSIGSDTLVMIATDRISAFDVILPQGIPYKGQILNQIASKFLDVTADIVPNWKLATPDPMATVGLRCEPFKVEMVIRGYLTGSAWREYKAGARTLCGIVLPKGMKENEKFPSPIITPTTKADEGHDQNISKEEIIALGLVGRDDYEQLERYTQALFRRGTEIAAQKGLILVDTKYEFGKKDGKIYLIDEIHTPDSSRYFYMDGYWERFAKGEEQKQLSKEFVRKWLIDNGFQGKEGQTIPEMTPAYCKSVSGRYIELYEKITGEKFIKSDSRDVAGRIEKNVKDYLSNNGSIRLNR
Sample Types
Isolate
14.1%
Metagenome
85.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.4%
Termitidae
20.7%
Unclassified
17.4%
Kalotermitidae
15.2%
Rhinotermitidae
5.4%
Termopsidae
4.3%
Passalidae
2.2%
Armadillidiidae
2.2%
Hydrophilidae
1.1%
Hodotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
324
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 2 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 3 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 4 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 5 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 6 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 7 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 8 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 9 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 10 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 11 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 21 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 22 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 23 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 24 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 28 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 29 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 30 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 31 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 32 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 33 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 34 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 35 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 36 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 37 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 38 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 39 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 40 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 41 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 42 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 43 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 44 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 51 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 52 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 53 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 54 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 55 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 56 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 57 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 58 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 59 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 60 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 61 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 62 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 63 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 64 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 65 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 66 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 67 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 68 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 69 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 70 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 71 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 72 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 73 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 74 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 75 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 76 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 77 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 78 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 79 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 80 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 81 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 82 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 83 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 84 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 85 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 86 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 87 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 88 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 89 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 90 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 91 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 92 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 93 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_168807 | 3300042659 | Bacteria | 2733 |
| 2 | Ga0466733_181992 | 3300042659 | Bacteria | 4963 |
| 3 | Ga0466711_497915 | 3300042615 | Bacteria | 1961 |
| 4 | Ga0466723_367764 | 3300042618 | Bacteria | 7440 |
| 5 | Ga0466728_065637 | 3300042620 | Bacteria | 74528 |
| 6 | Ga0466728_082838 | 3300042620 | Bacteria | 7309 |
| 7 | Ga0466690_315715 | 3300042590 | Bacteria | 12562 |
| 8 | Ga0466692_084653 | 3300042591 | Bacteria | 16158 |
| 9 | Ga0466696_077438 | 3300042596 | Bacteria | 1205 |
| 10 | Ga0123354_10001155 | 3300010882 | Bacteria | 30901 |
| 11 | Ga0123354_10209160 | 3300010882 | Bacteria | 2115 |
| 12 | Ga0466735_068864 | 3300042624 | Bacteria | 13806 |
| 13 | Ga0466735_178592 | 3300042624 | Bacteria | 3256 |
| 14 | Ga0466703_357383 | 3300042636 | Bacteria | 7395 |
| 15 | Ga0466704_442642 | 3300042643 | Bacteria | 41618 |
| 16 | Ga0466708_006861 | 3300042652 | Bacteria | 10307 |
| 17 | Ga0466706_084855 | 3300042599 | Bacteria | 1809 |
| 18 | Ga0466706_085014 | 3300042599 | Bacteria | 13335 |
| 19 | Ga0466706_180902 | 3300042599 | Bacteria | 4640 |
| 20 | Ga0466706_196847 | 3300042599 | Bacteria | 22766 |
| 21 | Ga0466713_008813 | 3300042602 | Bacteria | 15834 |
| 22 | Ga0466719_375247 | 3300042606 | Bacteria | 6982 |
| 23 | IMNBL1DRAFT_c0026445 | 3300000062 | Bacteria | 2203 |
| 24 | JGI24699J35502_11134110 | 3300002509 | Bacteria | 31696 |
| 25 | Ga0068305_10010547 | 3300005083 | Bacteria | 6272 |
| 26 | Ga0123357_10000872 | 3300009784 | Bacteria | 30777 |
| 27 | Ga0466733_017290 | 3300042659 | Bacteria | 27106 |
| 28 | Ga0466733_093142 | 3300042659 | Bacteria | 1129 |
| 29 | Ga0466733_123302 | 3300042659 | Bacteria | 57975 |
| 30 | Ga0466711_339108 | 3300042615 | Bacteria | 40685 |
| 31 | Ga0466723_214552 | 3300042618 | Bacteria | 46791 |
| 32 | Ga0160433_100237 | 3300012846 | Bacteria | 40097 |
| 33 | Ga0466690_043076 | 3300042590 | Bacteria | 9908 |
| 34 | Ga0466690_086675 | 3300042590 | Bacteria | 50714 |
| 35 | Ga0466690_169422 | 3300042590 | Bacteria | 39612 |
| 36 | Ga0466693_095506 | 3300042592 | Bacteria | 1419 |
| 37 | Ga0466691_203048 | 3300042593 | Bacteria | 4850 |
| 38 | Ga0466696_118502 | 3300042596 | Bacteria | 7051 |
| 39 | Ga0466696_484302 | 3300042596 | Bacteria | 7928 |
| 40 | Ga0123355_10005609 | 3300009826 | Bacteria | 18412 |
| 41 | Ga0123353_10034491 | 3300010167 | Bacteria | 7899 |
| 42 | Ga0123353_10857439 | 3300010167 | Bacteria | 1244 |
| 43 | Ga0123354_10156686 | 3300010882 | Bacteria | 2728 |
| 44 | Ga0466735_139595 | 3300042624 | Bacteria | 8713 |
| 45 | Ga0466703_152613 | 3300042636 | Bacteria | 2626 |
| 46 | Ga0466703_257181 | 3300042636 | Bacteria | 10777 |
| 47 | Ga0466709_400231 | 3300042648 | Bacteria | 20448 |
| 48 | Ga0466708_026519 | 3300042652 | Bacteria | 4505 |
| 49 | Ga0466727_016369 | 3300042655 | Bacteria | 9576 |
| 50 | Ga0466727_078492 | 3300042655 | Bacteria | 66886 |
| 51 | Ga0466706_278104 | 3300042599 | Bacteria | 62605 |
| 52 | Ga0466707_117040 | 3300042601 | Bacteria | 22070 |
| 53 | Ga0466707_192408 | 3300042601 | Bacteria | 3735 |
| 54 | Ga0466713_044686 | 3300042602 | Bacteria | 17655 |
| 55 | Ga0466713_099518 | 3300042602 | Bacteria | 11417 |
| 56 | Ga0466722_123031 | 3300042609 | Bacteria | 32122 |
| 57 | Ga0466722_167758 | 3300042609 | Bacteria | 49106 |
| 58 | IMNBL1DRAFT_c0003350 | 3300000062 | Bacteria | 10392 |
| 59 | Ga0068302_10014172 | 3300005071 | Bacteria | 2734 |
| 60 | Ga0072941_1683484 | 3300005201 | Bacteria | 1753 |
| 61 | Ga0123357_10002530 | 3300009784 | Bacteria | 20462 |
| 62 | Ga0466732_055417 | 3300042656 | Bacteria | 4093 |
| 63 | Ga0466733_013021 | 3300042659 | Bacteria | 5721 |
| 64 | Ga0466733_210608 | 3300042659 | Bacteria | 40939 |
| 65 | Ga0466711_055109 | 3300042615 | Bacteria | 3765 |
| 66 | Ga0466711_251560 | 3300042615 | Bacteria | 14437 |
| 67 | Ga0466715_007764 | 3300042616 | Bacteria | 9097 |
| 68 | Ga0466723_269975 | 3300042618 | Bacteria | 19626 |
| 69 | Ga0466723_273364 | 3300042618 | Bacteria | 7459 |
| 70 | Ga0466726_144572 | 3300042619 | Bacteria | 3072 |
| 71 | Ga0466656_182629 | 3300042550 | Bacteria | 2679 |
| 72 | Ga0466691_005837 | 3300042593 | Bacteria | 2664 |
| 73 | Ga0466696_243101 | 3300042596 | Bacteria | 6507 |
| 74 | Ga0466696_244978 | 3300042596 | Bacteria | 67990 |
| 75 | Ga0123353_10113657 | 3300010167 | Bacteria | 4358 |
| 76 | Ga0123353_10238098 | 3300010167 | Bacteria | 2831 |
| 77 | Ga0466735_061706 | 3300042624 | Bacteria | 2902 |
| 78 | Ga0466703_020379 | 3300042636 | Bacteria | 3523 |
| 79 | Ga0466703_132013 | 3300042636 | Bacteria | 17736 |
| 80 | Ga0466709_124130 | 3300042648 | Bacteria | 272718 |
| 81 | Ga0466709_164902 | 3300042648 | Bacteria | 31389 |
| 82 | Ga0466725_055889 | 3300042654 | Bacteria | 8085 |
| 83 | Ga0466727_033460 | 3300042655 | Bacteria | 3360 |
| 84 | Ga0466713_119583 | 3300042602 | Bacteria | 22167 |
| 85 | Ga0466714_082057 | 3300042603 | Bacteria | 1703 |
| 86 | Ga0466719_327705 | 3300042606 | Bacteria | 1128 |
| 87 | 2227150249 | 2225789004 | Bacteria | 8560 |
| 88 | 2227205802 | 2225789004 | Bacteria | 7699 |
| 89 | IMNBL1DRAFT_c0007321 | 3300000062 | Bacteria | 5834 |
| 90 | IMNBL1DRAFT_c0020023 | 3300000062 | Bacteria | 2722 |
| 91 | IMNBL1DRAFT_c0023180 | 3300000062 | Bacteria | 2439 |
| 92 | Ga0123357_10003145 | 3300009784 | Bacteria | 18768 |
| 93 | Ga0466705_232740 | 3300042612 | Bacteria | 7883 |
| 94 | Ga0466733_118416 | 3300042659 | Bacteria | 8379 |
| 95 | Ga0466733_137357 | 3300042659 | Bacteria | 20030 |
| 96 | Ga0466733_188654 | 3300042659 | Bacteria | 2649 |
| 97 | Ga0466711_211198 | 3300042615 | Bacteria | 13306 |
| 98 | Ga0466715_634006 | 3300042616 | Bacteria | 8502 |
| 99 | Ga0466726_029778 | 3300042619 | Bacteria | 38816 |
| 100 | Ga0466729_164305 | 3300042621 | Bacteria | 1708 |
| 101 | Ga0466690_082013 | 3300042590 | Bacteria | 8015 |
| 102 | Ga0466692_183742 | 3300042591 | Bacteria | 15201 |
| 103 | Ga0466699_058816 | 3300042597 | Bacteria | 2224 |
| 104 | Ga0123354_10009959 | 3300010882 | Bacteria | 14607 |
| 105 | Ga0466729_244909 | 3300042621 | Bacteria | 11695 |
| 106 | Ga0466735_026871 | 3300042624 | Bacteria | 47904 |
| 107 | Ga0466735_235240 | 3300042624 | Bacteria | 4401 |
| 108 | Ga0466704_377176 | 3300042643 | Bacteria | 9517 |
| 109 | Ga0466704_387159 | 3300042643 | Bacteria | 11253 |
| 110 | Ga0466704_456616 | 3300042643 | Bacteria | 35507 |
| 111 | Ga0466708_047809 | 3300042652 | Bacteria | 7346 |
| 112 | Ga0466708_316968 | 3300042652 | Bacteria | 1659 |
| 113 | Ga0466706_011190 | 3300042599 | Bacteria | 34638 |
| 114 | Ga0466707_359244 | 3300042601 | Bacteria | 1224 |
| 115 | Ga0466713_037010 | 3300042602 | Bacteria | 2734 |
| 116 | Ga0466713_070992 | 3300042602 | Bacteria | 25946 |
| 117 | Ga0466713_097139 | 3300042602 | Bacteria | 4943 |
| 118 | Ga0466714_093145 | 3300042603 | Bacteria | 22265 |
| 119 | Ga0466716_228652 | 3300042605 | Bacteria | 1026 |
| 120 | Ga0466719_422169 | 3300042606 | Bacteria | 6241 |
| 121 | Ga0466719_480269 | 3300042606 | Bacteria | 1421 |
| 122 | Ga0466722_005814 | 3300042609 | Bacteria | 5469 |
| 123 | Ga0466722_139151 | 3300042609 | Bacteria | 3841 |
| 124 | Ga0466722_252821 | 3300042609 | Bacteria | 235840 |
| 125 | IMNBL1DRAFT_c0048444 | 3300000062 | Bacteria | 1363 |
| 126 | Ga0123357_10000910 | 3300009784 | Bacteria | 30052 |
| 127 | Ga0466733_089767 | 3300042659 | Bacteria | 58709 |
| 128 | Ga0466711_041526 | 3300042615 | Bacteria | 1330 |
| 129 | Ga0466711_340964 | 3300042615 | Bacteria | 8953 |
| 130 | Ga0466711_400719 | 3300042615 | Bacteria | 7593 |
| 131 | Ga0466715_254763 | 3300042616 | Bacteria | 1187 |
| 132 | Ga0466715_310411 | 3300042616 | Bacteria | 2718 |
| 133 | Ga0466723_012267 | 3300042618 | Bacteria | 11995 |
| 134 | Ga0466723_203504 | 3300042618 | Bacteria | 15515 |
| 135 | Ga0466728_044780 | 3300042620 | Bacteria | 82368 |
| 136 | Ga0466690_080367 | 3300042590 | Bacteria | 8109 |
| 137 | Ga0466690_213523 | 3300042590 | Bacteria | 18139 |
| 138 | Ga0466690_366927 | 3300042590 | Bacteria | 1901 |
| 139 | Ga0466692_203347 | 3300042591 | Bacteria | 2616 |
| 140 | Ga0466693_249023 | 3300042592 | Bacteria | 2250 |
| 141 | Ga0466696_017950 | 3300042596 | Bacteria | 25498 |
| 142 | Ga0466696_023129 | 3300042596 | Bacteria | 17572 |
| 143 | Ga0123357_10004638 | 3300009784 | Bacteria | 16215 |
| 144 | Ga0123357_10157774 | 3300009784 | Bacteria | 2731 |
| 145 | Ga0123354_10018138 | 3300010882 | Bacteria | 11032 |
| 146 | Ga0466735_090104 | 3300042624 | Bacteria | 3611 |
| 147 | Ga0466703_073917 | 3300042636 | Bacteria | 17781 |
| 148 | Ga0466703_128730 | 3300042636 | Bacteria | 17295 |
| 149 | Ga0466703_151711 | 3300042636 | Bacteria | 14208 |
| 150 | Ga0466704_202906 | 3300042643 | Bacteria | 7773 |
| 151 | Ga0466704_339896 | 3300042643 | Bacteria | 5442 |
| 152 | Ga0466709_253747 | 3300042648 | Bacteria | 11213 |
| 153 | Ga0466727_232106 | 3300042655 | Bacteria | 6472 |
| 154 | Ga0466706_068903 | 3300042599 | Bacteria | 60225 |
| 155 | Ga0466700_255519 | 3300042600 | Bacteria | 3249 |
| 156 | Ga0466707_109853 | 3300042601 | Bacteria | 18130 |
| 157 | Ga0466714_146836 | 3300042603 | Bacteria | 1937 |
| 158 | Ga0466719_551460 | 3300042606 | Bacteria | 2843 |
| 159 | JGI24699J35502_11133947 | 3300002509 | Bacteria | 20626 |
| 160 | Ga0068305_10000572 | 3300005083 | Bacteria | 10924 |
| 161 | Ga0466705_113076 | 3300042612 | Bacteria | 5316 |
| 162 | Ga0466705_295774 | 3300042612 | Bacteria | 17164 |
| 163 | Ga0466715_367302 | 3300042616 | Bacteria | 9027 |
| 164 | Ga0466718_001067 | 3300042617 | Bacteria | 1763 |
| 165 | Ga0466728_189190 | 3300042620 | Bacteria | 66661 |
| 166 | Ga0466728_251024 | 3300042620 | Bacteria | 4848 |
| 167 | Ga0466690_133036 | 3300042590 | Bacteria | 7695 |
| 168 | Ga0466692_021898 | 3300042591 | Bacteria | 3903 |
| 169 | Ga0466692_184435 | 3300042591 | Bacteria | 106081 |
| 170 | Ga0466692_194921 | 3300042591 | Bacteria | 2914 |
| 171 | Ga0466691_010436 | 3300042593 | Bacteria | 8049 |
| 172 | Ga0466696_087240 | 3300042596 | Bacteria | 9499 |
| 173 | Ga0123357_10117070 | 3300009784 | Bacteria | 3372 |
| 174 | Ga0123353_10000014 | 3300010167 | Bacteria | 204767 |
| 175 | Ga0123354_10037221 | 3300010882 | Bacteria | 7576 |
| 176 | Ga0466729_227461 | 3300042621 | Bacteria | 1377 |
| 177 | Ga0466703_068053 | 3300042636 | Bacteria | 4846 |
| 178 | Ga0466703_120209 | 3300042636 | Bacteria | 3614 |
| 179 | Ga0466704_089145 | 3300042643 | Bacteria | 13225 |
| 180 | Ga0466709_397134 | 3300042648 | Bacteria | 10448 |
| 181 | Ga0466708_035884 | 3300042652 | Bacteria | 37329 |
| 182 | Ga0466727_307411 | 3300042655 | Bacteria | 80907 |
| 183 | Ga0466706_230496 | 3300042599 | Bacteria | 22639 |
| 184 | Ga0466700_093193 | 3300042600 | Bacteria | 4167 |
| 185 | Ga0466713_050394 | 3300042602 | Bacteria | 6134 |
| 186 | Ga0466713_070167 | 3300042602 | Bacteria | 16498 |
| 187 | Ga0466713_118181 | 3300042602 | Bacteria | 33659 |
| 188 | Ga0466714_096091 | 3300042603 | Bacteria | 1887 |
| 189 | Ga0466716_040579 | 3300042605 | Bacteria | 5793 |
| 190 | Ga0466722_170864 | 3300042609 | Bacteria | 1819 |
| 191 | Ga0466722_226639 | 3300042609 | Bacteria | 3048 |
| 192 | Ga0466698_477204 | 3300042610 | Bacteria | 2027 |
| 193 | IMNBL1DRAFT_c0004215 | 3300000062 | Bacteria | 8732 |
| 194 | IMNBL1DRAFT_c0005390 | 3300000062 | Bacteria | 7328 |
| 195 | JGI24702J35022_10001703 | 3300002462 | Bacteria | 13632 |
| 196 | JGI24699J35502_11134146 | 3300002509 | Bacteria | 37464 |
| 197 | Ga0068305_10176128 | 3300005083 | Bacteria | 2187 |
| 198 | Ga0466705_085608 | 3300042612 | Bacteria | 1713 |
| 199 | Ga0466705_112779 | 3300042612 | Bacteria | 20416 |
| 200 | Ga0466705_207168 | 3300042612 | Bacteria | 18002 |
| 201 | Ga0466732_063603 | 3300042656 | Unclassified | 3522 |
| 202 | Ga0466733_170866 | 3300042659 | Bacteria | 2333 |
| 203 | Ga0466711_182580 | 3300042615 | Bacteria | 4765 |
| 204 | Ga0466715_115457 | 3300042616 | Bacteria | 36939 |
| 205 | Ga0466715_137211 | 3300042616 | Bacteria | 4758 |
| 206 | Ga0466726_064138 | 3300042619 | Bacteria | 29723 |
| 207 | Ga0466726_425657 | 3300042619 | Bacteria | 2575 |
| 208 | Ga0466728_057053 | 3300042620 | Bacteria | 63684 |
| 209 | Ga0466728_079698 | 3300042620 | Bacteria | 13319 |
| 210 | Ga0466690_036195 | 3300042590 | Bacteria | 1099 |
| 211 | Ga0466690_094063 | 3300042590 | Bacteria | 25360 |
| 212 | Ga0466692_083632 | 3300042591 | Bacteria | 30510 |
| 213 | Ga0466691_179572 | 3300042593 | Bacteria | 130258 |
| 214 | Ga0466696_094752 | 3300042596 | Bacteria | 1652 |
| 215 | Ga0123353_10303656 | 3300010167 | Bacteria | 2434 |
| 216 | Ga0466735_057519 | 3300042624 | Bacteria | 1533 |
| 217 | Ga0466735_066837 | 3300042624 | Bacteria | 5459 |
| 218 | Ga0466703_148257 | 3300042636 | Bacteria | 24506 |
| 219 | Ga0466703_334260 | 3300042636 | Bacteria | 18184 |
| 220 | Ga0466709_039419 | 3300042648 | Bacteria | 67557 |
| 221 | Ga0466724_62948 | 3300042649 | Bacteria | 1830 |
| 222 | Ga0466706_219199 | 3300042599 | Bacteria | 1287 |
| 223 | Ga0466707_017877 | 3300042601 | Bacteria | 16904 |
| 224 | Ga0466707_039777 | 3300042601 | Bacteria | 1210 |
| 225 | Ga0466713_075594 | 3300042602 | Bacteria | 34756 |
| 226 | Ga0466713_122611 | 3300042602 | Bacteria | 62960 |
| 227 | Ga0466713_128762 | 3300042602 | Bacteria | 2477 |
| 228 | Ga0466713_144029 | 3300042602 | Bacteria | 8908 |
| 229 | Ga0466714_038352 | 3300042603 | Bacteria | 65655 |
| 230 | Ga0466714_072169 | 3300042603 | Bacteria | 1866 |
| 231 | Ga0466716_285995 | 3300042605 | Bacteria | 19976 |
| 232 | Ga0466716_395133 | 3300042605 | Bacteria | 6728 |
| 233 | Ga0466719_040113 | 3300042606 | Bacteria | 1912 |
| 234 | Ga0466722_024720 | 3300042609 | Bacteria | 7488 |
| 235 | Ga0466722_165379 | 3300042609 | Bacteria | 5369 |
| 236 | 2227358582 | 2225789004 | Bacteria | 27844 |
| 237 | JGI24696J40584_12955629 | 3300002834 | Bacteria | 2883 |
| 238 | Ga0072941_1150265 | 3300005201 | Bacteria | 4275 |
| 239 | Ga0466705_112417 | 3300042612 | Bacteria | 33433 |
| 240 | Ga0466732_185719 | 3300042656 | Bacteria | 4833 |
| 241 | Ga0466733_106246 | 3300042659 | Bacteria | 308825 |
| 242 | Ga0466711_120514 | 3300042615 | Bacteria | 6869 |
| 243 | Ga0466715_214341 | 3300042616 | Bacteria | 4145 |
| 244 | Ga0466715_217453 | 3300042616 | Bacteria | 12172 |
| 245 | Ga0466715_376224 | 3300042616 | Bacteria | 43713 |
| 246 | Ga0466715_418614 | 3300042616 | Bacteria | 10736 |
| 247 | Ga0466723_002809 | 3300042618 | Bacteria | 5706 |
| 248 | Ga0466726_127136 | 3300042619 | Bacteria | 4669 |
| 249 | Ga0466728_386646 | 3300042620 | Bacteria | 14940 |
| 250 | Ga0160455_100125 | 3300012837 | Bacteria | 101080 |
| 251 | Ga0466690_397619 | 3300042590 | Bacteria | 13613 |
| 252 | Ga0466692_176925 | 3300042591 | Bacteria | 3130 |
| 253 | Ga0466691_168669 | 3300042593 | Bacteria | 22573 |
| 254 | Ga0466696_387414 | 3300042596 | Bacteria | 21871 |
| 255 | Ga0123354_10244614 | 3300010882 | Bacteria | 1835 |
| 256 | Ga0123354_10336040 | 3300010882 | Bacteria | 1369 |
| 257 | Ga0466735_007579 | 3300042624 | Bacteria | 4984 |
| 258 | Ga0466735_235111 | 3300042624 | Bacteria | 1921 |
| 259 | Ga0466703_414575 | 3300042636 | Bacteria | 31524 |
| 260 | Ga0466704_453844 | 3300042643 | Bacteria | 13748 |
| 261 | Ga0466704_495022 | 3300042643 | Bacteria | 5171 |
| 262 | Ga0466708_080566 | 3300042652 | Bacteria | 94583 |
| 263 | Ga0466727_084560 | 3300042655 | Bacteria | 3622 |
| 264 | Ga0466727_136142 | 3300042655 | Bacteria | 5923 |
| 265 | Ga0466701_045480 | 3300042598 | Bacteria | 35486 |
| 266 | Ga0466701_099988 | 3300042598 | Bacteria | 1168 |
| 267 | Ga0466706_042394 | 3300042599 | Unclassified | 1030 |
| 268 | Ga0466706_079798 | 3300042599 | Bacteria | 1027 |
| 269 | Ga0466706_217566 | 3300042599 | Bacteria | 1457 |
| 270 | Ga0466707_057971 | 3300042601 | Bacteria | 5446 |
| 271 | Ga0466707_135525 | 3300042601 | Bacteria | 5929 |
| 272 | Ga0466713_078478 | 3300042602 | Bacteria | 6946 |
| 273 | Ga0466714_135302 | 3300042603 | Bacteria | 14942 |
| 274 | Ga0466716_161587 | 3300042605 | Bacteria | 1117 |
| 275 | Ga0466719_428043 | 3300042606 | Bacteria | 4592 |
| 276 | Ga0466722_093816 | 3300042609 | Bacteria | 18976 |
| 277 | Ga0466722_114842 | 3300042609 | Bacteria | 14416 |
| 278 | 2227480781 | 2225789004 | Bacteria | 4440 |
| 279 | IMNBL1DRAFT_c0002786 | 3300000062 | Bacteria | 11849 |
| 280 | IMNBL1DRAFT_c0011038 | 3300000062 | Bacteria | 4255 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01259 | SAICAR_synt | SAICAR synthetase | 38 | 277 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.