Protein Family IF09528
Metagenome
Isolate
329
Members
86
Samples
297
Scaffolds
483.9
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_507270|Ga0466704_507270_588_2174
- Length
- 528 aa
- Sequence
- MGISPFRTNKNFLLSIENLNFAPHEKENVVVAKFQNGMNILSLFVVVPVLMIVALFLCKGMKSIRTVMITGASALVVLATVLTVLFFQQRAVSDAEMLFVSSIDWYKPLHISYAVGVDGISVAMLCLSSIIVFTGVFSSWNMTMAKEYFLWYCLLSVGVFGFFISIDLFTMFMFYEVALIPMYLLIGLWGTGKKEYSAMKLTLMLMGGSAFLMIGIIGIYYAAGHTTMNLLEIAHLSIPMEYQRWLFPATFLGFGVLGALFPFHTWSPDGHASAPTAVSMLHAGVLMKLGGYGCFRVAMYLMPEAAQELGWIFLILTGISVVYGAFSAVVQTDLKYINAYSSVSHCGLVLFALLMMNQTAMTGAVMQMLSHGLMTALFFALIGLIYGRTHTRDIREMGGLMKIMPFASVCYVVAGLASLGLPGLSGFVAEMTIFVGSFQQADLFHRSFTVAACCSIVITAVYILRTVGKILYGPVQDTHHIGLPDAAWYEKVSVVVLIAGIAFIGMYPFGVSGMISDSLSPIVSKLSF
Sample Types
Isolate
9.7%
Metagenome
90.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.8%
Blattidae
17.6%
Unclassified
15.3%
Kalotermitidae
15.3%
Rhinotermitidae
8.2%
Termopsidae
4.7%
Hydrophilidae
2.4%
Passalidae
2.4%
Hodotermitidae
1.2%
Tenebrionidae
1.2%
Taxonomy
Archaea
0
Bacteria
307
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 2 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 3 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 7 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 15 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 16 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 17 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 22 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 23 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 32 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 38 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 39 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 40 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 47 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 48 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 49 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 50 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 51 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 52 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 53 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 54 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 55 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 56 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 57 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 58 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 59 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 60 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 61 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 62 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 63 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 64 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 67 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 68 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 69 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 70 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 71 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 72 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 73 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 74 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 75 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 76 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 77 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 78 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 79 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 80 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 81 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 82 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 83 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 84 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 85 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 86 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_073835 | 3300042612 | Bacteria | 13642 |
| 2 | Ga0466710_015319 | 3300042613 | Bacteria | 2038 |
| 3 | Ga0466711_435970 | 3300042615 | Bacteria | 27962 |
| 4 | Ga0466715_105012 | 3300042616 | Bacteria | 13340 |
| 5 | Ga0466723_092051 | 3300042618 | Bacteria | 16294 |
| 6 | Ga0466726_453342 | 3300042619 | Bacteria | 3819 |
| 7 | Ga0456237_0000012 | 3300041968 | Bacteria | 42362 |
| 8 | Ga0466656_064781 | 3300042550 | Bacteria | 21643 |
| 9 | Ga0466692_004605 | 3300042591 | Bacteria | 4179 |
| 10 | Ga0466692_104877 | 3300042591 | Bacteria | 8727 |
| 11 | Ga0466701_028485 | 3300042598 | Bacteria | 4079 |
| 12 | Ga0466700_026256 | 3300042600 | Bacteria | 21450 |
| 13 | Ga0466707_323672 | 3300042601 | Bacteria | 13232 |
| 14 | Ga0466707_416919 | 3300042601 | Bacteria | 6327 |
| 15 | Ga0466713_037944 | 3300042602 | Bacteria | 60611 |
| 16 | Ga0466713_055128 | 3300042602 | Bacteria | 14066 |
| 17 | Ga0466713_069206 | 3300042602 | Bacteria | 4085 |
| 18 | Ga0466714_011714 | 3300042603 | Bacteria | 47582 |
| 19 | Ga0466714_051125 | 3300042603 | Bacteria | 52861 |
| 20 | Ga0466719_285181 | 3300042606 | Unclassified | 10381 |
| 21 | Ga0466722_113613 | 3300042609 | Bacteria | 129604 |
| 22 | IMNBL1DRAFT_c0002023 | 3300000062 | Bacteria | 14529 |
| 23 | IMNBL1DRAFT_c0007464 | 3300000062 | Bacteria | 5747 |
| 24 | IMNBL1DRAFT_c0010893 | 3300000062 | Bacteria | 4302 |
| 25 | Ga0466735_059932 | 3300042624 | Unclassified | 1651 |
| 26 | Ga0466735_099068 | 3300042624 | Bacteria | 2558 |
| 27 | Ga0466735_186187 | 3300042624 | Bacteria | 5095 |
| 28 | Ga0466735_231819 | 3300042624 | Bacteria | 1779 |
| 29 | Ga0466704_481782 | 3300042643 | Bacteria | 1599 |
| 30 | Ga0466725_280620 | 3300042654 | Bacteria | 1597 |
| 31 | Ga0466727_248125 | 3300042655 | Bacteria | 3381 |
| 32 | Ga0123357_10060063 | 3300009784 | Bacteria | 5100 |
| 33 | Ga0123356_10043827 | 3300010049 | Bacteria | 4166 |
| 34 | Ga0123354_10049615 | 3300010882 | Bacteria | 6363 |
| 35 | Ga0466705_335658 | 3300042612 | Bacteria | 24109 |
| 36 | Ga0466732_005715 | 3300042656 | Bacteria | 91596 |
| 37 | Ga0466733_032159 | 3300042659 | Bacteria | 19865 |
| 38 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 39 | Ga0466733_111102 | 3300042659 | Bacteria | 11052 |
| 40 | Ga0466733_134058 | 3300042659 | Bacteria | 6517 |
| 41 | Ga0466711_247006 | 3300042615 | Bacteria | 9768 |
| 42 | Ga0466711_390003 | 3300042615 | Bacteria | 31775 |
| 43 | Ga0466715_023105 | 3300042616 | Bacteria | 7276 |
| 44 | Ga0466715_105111 | 3300042616 | Unclassified | 2267 |
| 45 | Ga0466715_145136 | 3300042616 | Bacteria | 29917 |
| 46 | Ga0466723_314054 | 3300042618 | Bacteria | 8745 |
| 47 | Ga0466726_064602 | 3300042619 | Bacteria | 18009 |
| 48 | Ga0466657_391048 | 3300042582 | Bacteria | 2192 |
| 49 | Ga0466690_113560 | 3300042590 | Bacteria | 11704 |
| 50 | Ga0466690_272370 | 3300042590 | Bacteria | 10898 |
| 51 | Ga0466692_014618 | 3300042591 | Bacteria | 107882 |
| 52 | Ga0466692_032473 | 3300042591 | Bacteria | 22846 |
| 53 | Ga0466695_345093 | 3300042595 | Unclassified | 3076 |
| 54 | Ga0466696_126944 | 3300042596 | Bacteria | 2129 |
| 55 | Ga0466706_132256 | 3300042599 | Bacteria | 31081 |
| 56 | Ga0466706_174965 | 3300042599 | Bacteria | 2057 |
| 57 | Ga0466700_222758 | 3300042600 | Bacteria | 13877 |
| 58 | Ga0466707_068270 | 3300042601 | Bacteria | 10493 |
| 59 | Ga0466707_165299 | 3300042601 | Bacteria | 15086 |
| 60 | Ga0466713_001020 | 3300042602 | Bacteria | 4197 |
| 61 | Ga0466713_074755 | 3300042602 | Bacteria | 27009 |
| 62 | Ga0466713_096222 | 3300042602 | Bacteria | 1607 |
| 63 | Ga0466719_133612 | 3300042606 | Unclassified | 2105 |
| 64 | Ga0466698_025081 | 3300042610 | Bacteria | 3225 |
| 65 | 2227591289 | 2225789004 | Bacteria | 12992 |
| 66 | IMNBL1DRAFT_c0001921 | 3300000062 | Bacteria | 15041 |
| 67 | JGI24702J35022_10023360 | 3300002462 | Bacteria | 3344 |
| 68 | Ga0466704_148253 | 3300042643 | Bacteria | 20299 |
| 69 | Ga0466709_246569 | 3300042648 | Bacteria | 6238 |
| 70 | Ga0466725_210063 | 3300042654 | Bacteria | 11666 |
| 71 | Ga0466727_219718 | 3300042655 | Bacteria | 37959 |
| 72 | Ga0123354_10184680 | 3300010882 | Bacteria | 2364 |
| 73 | Ga0466705_032844 | 3300042612 | Bacteria | 18355 |
| 74 | Ga0466705_049385 | 3300042612 | Bacteria | 4196 |
| 75 | Ga0466705_132479 | 3300042612 | Unclassified | 4666 |
| 76 | Ga0466733_055799 | 3300042659 | Bacteria | 106016 |
| 77 | Ga0466705_431426 | 3300042612 | Bacteria | 9847 |
| 78 | Ga0466711_231326 | 3300042615 | Unclassified | 2741 |
| 79 | Ga0466711_294594 | 3300042615 | Bacteria | 3736 |
| 80 | Ga0466723_014215 | 3300042618 | Bacteria | 13889 |
| 81 | Ga0466723_171495 | 3300042618 | Bacteria | 6853 |
| 82 | Ga0466726_159696 | 3300042619 | Bacteria | 14259 |
| 83 | Ga0466726_275770 | 3300042619 | Bacteria | 15891 |
| 84 | Ga0466729_017058 | 3300042621 | Unclassified | 4325 |
| 85 | Ga0466690_103383 | 3300042590 | Bacteria | 29422 |
| 86 | Ga0466693_321533 | 3300042592 | Bacteria | 4005 |
| 87 | Ga0466696_027790 | 3300042596 | Bacteria | 10157 |
| 88 | Ga0466696_092974 | 3300042596 | Bacteria | 6536 |
| 89 | Ga0466696_305629 | 3300042596 | Bacteria | 12685 |
| 90 | Ga0466701_015903 | 3300042598 | Bacteria | 2111 |
| 91 | Ga0466701_046132 | 3300042598 | Bacteria | 5917 |
| 92 | Ga0466701_047249 | 3300042598 | Bacteria | 5964 |
| 93 | Ga0466701_063022 | 3300042598 | Unclassified | 5119 |
| 94 | Ga0466706_109799 | 3300042599 | Bacteria | 205088 |
| 95 | Ga0466707_073957 | 3300042601 | Bacteria | 5973 |
| 96 | Ga0466707_084944 | 3300042601 | Bacteria | 11504 |
| 97 | Ga0466707_359464 | 3300042601 | Bacteria | 15596 |
| 98 | Ga0466716_363582 | 3300042605 | Bacteria | 6636 |
| 99 | Ga0466719_028262 | 3300042606 | Bacteria | 7946 |
| 100 | Ga0466722_127034 | 3300042609 | Bacteria | 4056 |
| 101 | 2227319675 | 2225789004 | Unclassified | 6436 |
| 102 | JGI24705J35276_12228314 | 3300002504 | Bacteria | 3162 |
| 103 | Ga0466704_077859 | 3300042643 | Bacteria | 3690 |
| 104 | Ga0466704_200101 | 3300042643 | Bacteria | 33375 |
| 105 | Ga0466704_488080 | 3300042643 | Bacteria | 6701 |
| 106 | Ga0466708_223269 | 3300042652 | Bacteria | 26840 |
| 107 | Ga0466727_036996 | 3300042655 | Bacteria | 4934 |
| 108 | Ga0466727_168488 | 3300042655 | Bacteria | 5527 |
| 109 | Ga0123357_10027236 | 3300009784 | Bacteria | 7724 |
| 110 | Ga0123354_10019651 | 3300010882 | Bacteria | 10608 |
| 111 | Ga0466705_386629 | 3300042612 | Bacteria | 7874 |
| 112 | Ga0466733_026924 | 3300042659 | Bacteria | 17906 |
| 113 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 114 | Ga0466711_172329 | 3300042615 | Bacteria | 9572 |
| 115 | Ga0466715_270198 | 3300042616 | Bacteria | 10479 |
| 116 | Ga0466715_293034 | 3300042616 | Bacteria | 14484 |
| 117 | Ga0466715_377418 | 3300042616 | Bacteria | 1929 |
| 118 | Ga0466723_032717 | 3300042618 | Bacteria | 15968 |
| 119 | Ga0466723_251100 | 3300042618 | Bacteria | 11304 |
| 120 | Ga0466726_055719 | 3300042619 | Bacteria | 11749 |
| 121 | Ga0466726_098008 | 3300042619 | Bacteria | 12087 |
| 122 | Ga0466690_149899 | 3300042590 | Bacteria | 20818 |
| 123 | Ga0466692_089066 | 3300042591 | Bacteria | 3127 |
| 124 | Ga0466691_033214 | 3300042593 | Bacteria | 7487 |
| 125 | Ga0466695_384269 | 3300042595 | Bacteria | 7224 |
| 126 | Ga0466696_322293 | 3300042596 | Bacteria | 1715 |
| 127 | Ga0466701_061302 | 3300042598 | Unclassified | 1820 |
| 128 | Ga0466713_130991 | 3300042602 | Bacteria | 214088 |
| 129 | Ga0466714_061841 | 3300042603 | Bacteria | 10327 |
| 130 | Ga0466714_136077 | 3300042603 | Bacteria | 139396 |
| 131 | Ga0466714_150199 | 3300042603 | Bacteria | 149649 |
| 132 | Ga0466716_407487 | 3300042605 | Bacteria | 2678 |
| 133 | Ga0466719_034830 | 3300042606 | Bacteria | 7990 |
| 134 | Ga0466719_377296 | 3300042606 | Unclassified | 3503 |
| 135 | Ga0466722_013218 | 3300042609 | Bacteria | 7350 |
| 136 | Ga0466722_203583 | 3300042609 | Bacteria | 2643 |
| 137 | JGI24699J35502_11134228 | 3300002509 | Bacteria | 91082 |
| 138 | Ga0068302_10039160 | 3300005071 | Unclassified | 3153 |
| 139 | Ga0068305_10001607 | 3300005083 | Bacteria | 146538 |
| 140 | Ga0466735_091357 | 3300042624 | Bacteria | 1694 |
| 141 | Ga0466735_109059 | 3300042624 | Bacteria | 2100 |
| 142 | Ga0466735_154733 | 3300042624 | Unclassified | 1287 |
| 143 | Ga0466703_167618 | 3300042636 | Bacteria | 10138 |
| 144 | Ga0466703_187328 | 3300042636 | Bacteria | 25919 |
| 145 | Ga0466703_203837 | 3300042636 | Bacteria | 13462 |
| 146 | Ga0466703_219090 | 3300042636 | Unclassified | 2914 |
| 147 | Ga0466704_021274 | 3300042643 | Bacteria | 2454 |
| 148 | Ga0466704_036765 | 3300042643 | Bacteria | 16967 |
| 149 | Ga0466704_132770 | 3300042643 | Bacteria | 2159 |
| 150 | Ga0466704_396717 | 3300042643 | Bacteria | 26428 |
| 151 | Ga0466709_414483 | 3300042648 | Bacteria | 24643 |
| 152 | Ga0466708_267762 | 3300042652 | Bacteria | 4608 |
| 153 | Ga0466727_167278 | 3300042655 | Bacteria | 64897 |
| 154 | Ga0123356_10126726 | 3300010049 | Bacteria | 2494 |
| 155 | Ga0123354_10002580 | 3300010882 | Bacteria | 24135 |
| 156 | Ga0466705_050903 | 3300042612 | Bacteria | 11739 |
| 157 | Ga0466733_193586 | 3300042659 | Bacteria | 5573 |
| 158 | Ga0466715_095476 | 3300042616 | Bacteria | 15840 |
| 159 | Ga0466692_100902 | 3300042591 | Bacteria | 68262 |
| 160 | Ga0466694_224322 | 3300042594 | Bacteria | 6023 |
| 161 | Ga0466706_097878 | 3300042599 | Unclassified | 1926 |
| 162 | Ga0466706_107468 | 3300042599 | Bacteria | 3214 |
| 163 | Ga0466707_022169 | 3300042601 | Bacteria | 38620 |
| 164 | Ga0466707_242775 | 3300042601 | Bacteria | 11468 |
| 165 | Ga0466707_360182 | 3300042601 | Bacteria | 12987 |
| 166 | Ga0466713_033394 | 3300042602 | Bacteria | 24369 |
| 167 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 168 | Ga0466714_059913 | 3300042603 | Bacteria | 6037 |
| 169 | Ga0466714_091668 | 3300042603 | Bacteria | 24422 |
| 170 | Ga0466719_012506 | 3300042606 | Bacteria | 11641 |
| 171 | Ga0466719_026740 | 3300042606 | Bacteria | 10500 |
| 172 | Ga0466719_547111 | 3300042606 | Bacteria | 8384 |
| 173 | Ga0466722_094262 | 3300042609 | Bacteria | 9587 |
| 174 | 2227536864 | 2225789004 | Bacteria | 3057 |
| 175 | IMNBL1DRAFT_c0000105 | 3300000062 | Bacteria | 74361 |
| 176 | IMNBL1DRAFT_c0001104 | 3300000062 | Bacteria | 20698 |
| 177 | Ga0072941_1125050 | 3300005201 | Bacteria | 5684 |
| 178 | Ga0466734_028204 | 3300042623 | Bacteria | 3494 |
| 179 | Ga0466735_044630 | 3300042624 | Bacteria | 3928 |
| 180 | Ga0466730_029192 | 3300042625 | Bacteria | 6614 |
| 181 | Ga0466703_040225 | 3300042636 | Bacteria | 28005 |
| 182 | Ga0466703_309813 | 3300042636 | Bacteria | 5104 |
| 183 | Ga0466704_096003 | 3300042643 | Bacteria | 3900 |
| 184 | Ga0466704_096642 | 3300042643 | Bacteria | 11632 |
| 185 | Ga0466704_120644 | 3300042643 | Unclassified | 3740 |
| 186 | Ga0466704_193235 | 3300042643 | Bacteria | 11221 |
| 187 | Ga0466704_424216 | 3300042643 | Bacteria | 5738 |
| 188 | Ga0466704_507270 | 3300042643 | Bacteria | 10828 |
| 189 | Ga0466709_084097 | 3300042648 | Bacteria | 147707 |
| 190 | Ga0466724_55740 | 3300042649 | Bacteria | 6066 |
| 191 | Ga0466708_052037 | 3300042652 | Bacteria | 24057 |
| 192 | Ga0466727_107313 | 3300042655 | Bacteria | 4927 |
| 193 | Ga0466727_326225 | 3300042655 | Bacteria | 66208 |
| 194 | Ga0466705_161010 | 3300042612 | Bacteria | 6224 |
| 195 | Ga0466733_088005 | 3300042659 | Bacteria | 7472 |
| 196 | Ga0466733_203605 | 3300042659 | Bacteria | 93930 |
| 197 | Ga0466711_363408 | 3300042615 | Bacteria | 6761 |
| 198 | Ga0466715_156320 | 3300042616 | Bacteria | 9972 |
| 199 | Ga0466723_135452 | 3300042618 | Unclassified | 5028 |
| 200 | Ga0466723_251298 | 3300042618 | Bacteria | 10781 |
| 201 | Ga0466726_018972 | 3300042619 | Bacteria | 4296 |
| 202 | Ga0466690_221231 | 3300042590 | Bacteria | 12698 |
| 203 | Ga0466692_191366 | 3300042591 | Bacteria | 14423 |
| 204 | Ga0466691_206556 | 3300042593 | Bacteria | 24464 |
| 205 | Ga0466691_220517 | 3300042593 | Bacteria | 18441 |
| 206 | Ga0466701_053947 | 3300042598 | Bacteria | 3718 |
| 207 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 208 | Ga0466706_223272 | 3300042599 | Bacteria | 16796 |
| 209 | Ga0466707_008939 | 3300042601 | Bacteria | 6269 |
| 210 | Ga0466707_062128 | 3300042601 | Bacteria | 19135 |
| 211 | Ga0466707_361606 | 3300042601 | Bacteria | 1583 |
| 212 | Ga0466713_039084 | 3300042602 | Bacteria | 11546 |
| 213 | Ga0466713_064639 | 3300042602 | Bacteria | 150612 |
| 214 | Ga0466716_412067 | 3300042605 | Bacteria | 5980 |
| 215 | Ga0466722_045755 | 3300042609 | Bacteria | 2617 |
| 216 | Ga0466722_059790 | 3300042609 | Bacteria | 6144 |
| 217 | IMNBL1DRAFT_c0005279 | 3300000062 | Bacteria | 7444 |
| 218 | JGI24702J35022_10001815 | 3300002462 | Bacteria | 13143 |
| 219 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 220 | Ga0068302_10067103 | 3300005071 | Unclassified | 4572 |
| 221 | Ga0068305_10174174 | 3300005083 | Bacteria | 2186 |
| 222 | Ga0466729_212978 | 3300042621 | Bacteria | 5499 |
| 223 | Ga0466703_067792 | 3300042636 | Bacteria | 28120 |
| 224 | Ga0466703_145020 | 3300042636 | Bacteria | 5403 |
| 225 | Ga0466704_138475 | 3300042643 | Bacteria | 7246 |
| 226 | Ga0466709_010216 | 3300042648 | Bacteria | 14208 |
| 227 | Ga0466727_110459 | 3300042655 | Bacteria | 3912 |
| 228 | Ga0466727_218108 | 3300042655 | Bacteria | 13790 |
| 229 | Ga0123356_10090547 | 3300010049 | Bacteria | 2913 |
| 230 | Ga0123353_10181537 | 3300010167 | Bacteria | 3330 |
| 231 | Ga0123354_10000201 | 3300010882 | Bacteria | 51540 |
| 232 | Ga0466705_073303 | 3300042612 | Bacteria | 8864 |
| 233 | Ga0466705_301679 | 3300042612 | Bacteria | 30952 |
| 234 | Ga0466715_298519 | 3300042616 | Bacteria | 6380 |
| 235 | Ga0466715_349295 | 3300042616 | Bacteria | 45829 |
| 236 | Ga0466715_351050 | 3300042616 | Bacteria | 23393 |
| 237 | Ga0466715_576006 | 3300042616 | Bacteria | 10093 |
| 238 | Ga0466723_118109 | 3300042618 | Bacteria | 8156 |
| 239 | Ga0466726_169010 | 3300042619 | Bacteria | 5365 |
| 240 | Ga0466692_035439 | 3300042591 | Bacteria | 14978 |
| 241 | Ga0466693_388714 | 3300042592 | Bacteria | 2028 |
| 242 | Ga0466691_006371 | 3300042593 | Bacteria | 3719 |
| 243 | Ga0466691_056063 | 3300042593 | Bacteria | 20184 |
| 244 | Ga0466691_068618 | 3300042593 | Bacteria | 28516 |
| 245 | Ga0466696_434828 | 3300042596 | Bacteria | 6894 |
| 246 | Ga0466701_010273 | 3300042598 | Bacteria | 19948 |
| 247 | Ga0466706_276356 | 3300042599 | Bacteria | 20327 |
| 248 | Ga0466707_364600 | 3300042601 | Bacteria | 8981 |
| 249 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 250 | Ga0466713_133321 | 3300042602 | Bacteria | 8944 |
| 251 | Ga0466714_048480 | 3300042603 | Bacteria | 4996 |
| 252 | Ga0466714_066902 | 3300042603 | Bacteria | 2538 |
| 253 | Ga0466722_027550 | 3300042609 | Bacteria | 3055 |
| 254 | Ga0466722_226539 | 3300042609 | Bacteria | 5312 |
| 255 | IMNBL1DRAFT_c0010714 | 3300000062 | Bacteria | 4351 |
| 256 | JGI24702J35022_10005057 | 3300002462 | Bacteria | 7770 |
| 257 | JGI24699J35502_11134213 | 3300002509 | Bacteria | 63023 |
| 258 | Ga0123357_10001135 | 3300009784 | Bacteria | 27683 |
| 259 | Ga0466702_079180 | 3300042635 | Bacteria | 3819 |
| 260 | Ga0466703_031918 | 3300042636 | Bacteria | 8666 |
| 261 | Ga0466709_030260 | 3300042648 | Unclassified | 2131 |
| 262 | Ga0466708_087212 | 3300042652 | Unclassified | 2950 |
| 263 | Ga0466708_167099 | 3300042652 | Bacteria | 6149 |
| 264 | Ga0466727_348535 | 3300042655 | Bacteria | 11423 |
| 265 | Ga0466705_051371 | 3300042612 | Bacteria | 11634 |
| 266 | Ga0466705_062223 | 3300042612 | Unclassified | 4864 |
| 267 | Ga0466705_228183 | 3300042612 | Bacteria | 5509 |
| 268 | Ga0466705_357702 | 3300042612 | Bacteria | 27661 |
| 269 | Ga0466733_130577 | 3300042659 | Bacteria | 17591 |
| 270 | Ga0466711_242490 | 3300042615 | Bacteria | 19433 |
| 271 | Ga0466715_316208 | 3300042616 | Bacteria | 15437 |
| 272 | Ga0466729_096704 | 3300042621 | Bacteria | 15068 |
| 273 | Ga0466729_115703 | 3300042621 | Bacteria | 5020 |
| 274 | Ga0466690_075235 | 3300042590 | Bacteria | 10422 |
| 275 | Ga0466691_006239 | 3300042593 | Bacteria | 10188 |
| 276 | Ga0466696_026812 | 3300042596 | Bacteria | 27611 |
| 277 | Ga0466706_166913 | 3300042599 | Bacteria | 17962 |
| 278 | Ga0466707_011532 | 3300042601 | Bacteria | 9890 |
| 279 | Ga0466707_067461 | 3300042601 | Bacteria | 5923 |
| 280 | Ga0466713_010310 | 3300042602 | Bacteria | 41924 |
| 281 | Ga0466714_034160 | 3300042603 | Bacteria | 3735 |
| 282 | Ga0466716_431812 | 3300042605 | Bacteria | 8551 |
| 283 | IMNBL1DRAFT_c0001469 | 3300000062 | Bacteria | 17624 |
| 284 | Ga0466731_164719 | 3300042622 | Bacteria | 4039 |
| 285 | Ga0466731_233099 | 3300042622 | Bacteria | 2261 |
| 286 | Ga0466735_110297 | 3300042624 | Bacteria | 8315 |
| 287 | Ga0466735_181263 | 3300042624 | Bacteria | 4425 |
| 288 | Ga0466703_125175 | 3300042636 | Bacteria | 11887 |
| 289 | Ga0466703_167762 | 3300042636 | Bacteria | 8896 |
| 290 | Ga0466704_016352 | 3300042643 | Bacteria | 60527 |
| 291 | Ga0466704_602482 | 3300042643 | Bacteria | 52119 |
| 292 | Ga0466724_68974 | 3300042649 | Bacteria | 3002 |
| 293 | Ga0466708_077679 | 3300042652 | Bacteria | 12053 |
| 294 | Ga0466708_180323 | 3300042652 | Bacteria | 12622 |
| 295 | Ga0466727_000612 | 3300042655 | Bacteria | 11085 |
| 296 | Ga0123353_10066360 | 3300010167 | Bacteria | 5792 |
| 297 | Ga0123354_10000567 | 3300010882 | Bacteria | 38205 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00361 | Proton_antipo_M | Proton-conducting membrane transporter | 166 | 448 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.