Protein Family IF09514

Metagenome Isolate
272 Members
79 Samples
248 Scaffolds
320.81 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_461357|Ga0466704_461357_138_1241
Length
367 aa
Sequence
LYHFIARPRKIKQFPGEGFLIKVPEQSGRRCGLALAPFAPTTKEVAMKIVILDGYAENPGDLSWDALAELAGADALTVHDRTPAGQVAGRIGPAEIVLTNKTPISRADMEACPNLRYIGMLATGYNVVDAAAAAERGIPLCNIPTYGTTSVSQHTIALLLEVCHRAGHHSRAVHEGRWAGAPDWCFWDYPQIELSGKTMGVFGFGRIGQATGRIARAQGMEVIAYNRSHSRHGSDSASYVELDEFWPRADIIALHSPLFPELEGLINKDTISRMKDGVIIVNTARGQLINEADLAGALNSGKVYGAGLDVVSVEPIRPDNPLLGAKNCIITPHIAWSSLESRKRLMDTAVENLHAFLDGKPINVVNM

πŸ“Š Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 32.9%
Unclassified 22.4%
Kalotermitidae 18.4%
Rhinotermitidae 5.3%
Armadillidiidae 3.9%
Curculionidae 3.9%
Termopsidae 3.9%
Passalidae 2.6%
Blaberidae 1.3%
Scarabaeidae 1.3%
Culicidae 1.3%
Hodotermitidae 1.3%
Formicidae 1.3%

🌳 Taxonomy

Archaea 2
Bacteria 262
Eukaryota 0
Viruses 0
Unclassified 8

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
5 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
6 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
7 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
8 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
9 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
10 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
13 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
14 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
15 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
16 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
17 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
18 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
21 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
22 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
23 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
24 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
29 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
30 2772190975 Treponema sp. RmG30 Isolate Blaberidae
31 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
32 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
35 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
36 8100181737 Kosakonia sp. S58 Isolate Curculionidae
37 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
38 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
39 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
43 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
44 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
45 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
46 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
50 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
51 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
52 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
53 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
54 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
55 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
56 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
57 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
58 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
59 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
60 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
61 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
62 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
63 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
64 8100176769 Kosakonia sp. S57 Isolate Curculionidae
65 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
66 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
67 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
68 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
69 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
70 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
71 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
72 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
73 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
74 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
75 8100171289 Kosakonia sp. S42 Isolate Curculionidae
76 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
77 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
78 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
79 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_133071 3300042612 Bacteria 1584
2 Ga0466705_205909 3300042612 Bacteria 3410
3 Ga0466705_275779 3300042612 Bacteria 7832
4 Ga0466732_295235 3300042656 Bacteria 1961
5 Ga0415639_080134 3300038395 Bacteria 4754
6 Ga0466691_143649 3300042593 Archaea 3526
7 Ga0466694_019748 3300042594 Bacteria 8777
8 Ga0466695_328074 3300042595 Bacteria 2092
9 Ga0466696_407833 3300042596 Bacteria 8617
10 Ga0466699_227909 3300042597 Bacteria 2486
11 Ga0466705_394981 3300042612 Bacteria 4157
12 Ga0466711_099434 3300042615 Bacteria 7658
13 Ga0466711_436936 3300042615 Bacteria 1793
14 Ga0466715_195853 3300042616 Bacteria 12592
15 Ga0466715_384954 3300042616 Bacteria 3091
16 Ga0466715_536981 3300042616 Bacteria 36332
17 Ga0466723_313594 3300042618 Bacteria 97104
18 Ga0466726_468728 3300042619 Bacteria 5100
19 Ga0123353_10021970 3300010167 Bacteria 9598
20 Ga0123353_10333548 3300010167 Bacteria 2294
21 Ga0466713_131676 3300042602 Bacteria 30987
22 Ga0466719_107289 3300042606 Bacteria 2128
23 Ga0466719_456709 3300042606 Bacteria 2308
24 Ga0466719_504476 3300042606 Unclassified 2176
25 Ga0466722_013685 3300042609 Bacteria 3390
26 Ga0466722_036985 3300042609 Bacteria 64137
27 Ga0466722_051555 3300042609 Bacteria 1321
28 Ga0466722_080909 3300042609 Bacteria 4034
29 JGI24698J34947_10000486 3300002449 Bacteria 18665
30 JGI24695J34938_10088586 3300002450 Bacteria 1271
31 JGI24702J35022_10007173 3300002462 Bacteria 6405
32 JGI24702J35022_10134535 3300002462 Bacteria 1374
33 JGI24702J35022_10142684 3300002462 Bacteria 1338
34 Ga0466729_232590 3300042621 Bacteria 2731
35 Ga0466735_092839 3300042624 Unclassified 3603
36 Ga0466703_344825 3300042636 Bacteria 9564
37 Ga0466704_157119 3300042643 Bacteria 14318
38 Ga0466704_308416 3300042643 Bacteria 20776
39 Ga0466709_337099 3300042648 Bacteria 8028
40 Ga0466724_16530 3300042649 Bacteria 4490
41 Ga0466708_202981 3300042652 Bacteria 3258
42 Ga0466708_267514 3300042652 Bacteria 41870
43 Ga0466727_081927 3300042655 Bacteria 40056
44 Ga0466697_187322 3300042611 Bacteria 2247
45 Ga0466705_022437 3300042612 Bacteria 24966
46 Ga0466705_030668 3300042612 Bacteria 1792
47 Ga0466727_351338 3300042655 Bacteria 3154
48 Ga0466732_107391 3300042656 Bacteria 1451
49 Ga0160433_100299 3300012846 Bacteria 32102
50 Ga0415639_082739 3300038395 Bacteria 3225
51 Ga0466690_026381 3300042590 Bacteria 5546
52 Ga0466691_023429 3300042593 Bacteria 3482
53 Ga0466691_100450 3300042593 Bacteria 4630
54 Ga0466696_241566 3300042596 Bacteria 9952
55 Ga0466715_200032 3300042616 Bacteria 4524
56 Ga0466718_132896 3300042617 Bacteria 5812
57 Ga0466723_096115 3300042618 Bacteria 3884
58 Ga0466723_206154 3300042618 Bacteria 11370
59 Ga0123355_10002747 3300009826 Bacteria 24950
60 Ga0123353_10013433 3300010167 Bacteria 11730
61 Ga0466706_099508 3300042599 Unclassified 3005
62 Ga0466706_136685 3300042599 Bacteria 3146
63 Ga0466707_151783 3300042601 Bacteria 10732
64 Ga0466707_194382 3300042601 Bacteria 2854
65 Ga0466707_277588 3300042601 Bacteria 1574
66 Ga0466716_154736 3300042605 Bacteria 1305
67 Ga0466716_429330 3300042605 Bacteria 4371
68 Ga0466722_170370 3300042609 Bacteria 5968
69 Ga0123357_10000140 3300009784 Bacteria 63300
70 Ga0466708_163365 3300042652 Bacteria 10909
71 Ga0466708_464475 3300042652 Bacteria 69222
72 Ga0466697_258400 3300042611 Bacteria 3054
73 Ga0316159_10022 3300030930 Bacteria 39928
74 Ga0466696_214238 3300042596 Bacteria 1488
75 Ga0466705_434898 3300042612 Bacteria 1799
76 Ga0466705_450040 3300042612 Bacteria 3119
77 Ga0466711_183350 3300042615 Bacteria 47393
78 Ga0466715_269477 3300042616 Bacteria 5228
79 Ga0466715_437797 3300042616 Bacteria 6921
80 Ga0466715_541370 3300042616 Bacteria 1685
81 Ga0466723_259949 3300042618 Bacteria 9498
82 Ga0466726_283918 3300042619 Bacteria 1741
83 Ga0466728_208329 3300042620 Bacteria 3073
84 Ga0123355_10116697 3300009826 Bacteria 4152
85 Ga0123355_10439260 3300009826 Bacteria 1653
86 Ga0123353_10267796 3300010167 Bacteria 2634
87 Ga0123353_10480558 3300010167 Bacteria 1818
88 Ga0123353_10679953 3300010167 Bacteria 1450
89 Ga0123354_10315969 3300010882 Bacteria 1450
90 Ga0466706_113497 3300042599 Unclassified 1814
91 Ga0466707_214002 3300042601 Bacteria 3613
92 Ga0466713_007759 3300042602 Bacteria 7851
93 Ga0466713_017118 3300042602 Unclassified 23167
94 Ga0466713_126765 3300042602 Bacteria 2614
95 Ga0466714_032896 3300042603 Bacteria 2914
96 Ga0466719_148721 3300042606 Bacteria 1277
97 Ga0466719_322532 3300042606 Bacteria 1302
98 JGI24705J35276_12181108 3300002504 Bacteria 1369
99 Ga0466704_102481 3300042643 Bacteria 49033
100 Ga0466704_155123 3300042643 Bacteria 1141
101 Ga0466704_217881 3300042643 Unclassified 11193
102 Ga0466704_230609 3300042643 Bacteria 2681
103 Ga0466708_286021 3300042652 Archaea 6053
104 Ga0466725_104632 3300042654 Unclassified 2413
105 Ga0466727_079716 3300042655 Bacteria 8828
106 Ga0160445_101691 3300012847 Bacteria 5858
107 Ga0264413_141055 3300024493 Bacteria 8336
108 Ga0466690_114337 3300042590 Bacteria 3564
109 Ga0466690_159038 3300042590 Bacteria 2763
110 Ga0466694_116468 3300042594 Bacteria 4589
111 Ga0466694_329784 3300042594 Bacteria 4670
112 Ga0466694_366070 3300042594 Bacteria 1281
113 Ga0466715_088835 3300042616 Bacteria 19594
114 Ga0466715_182470 3300042616 Bacteria 7184
115 Ga0466715_189306 3300042616 Bacteria 3018
116 Ga0466728_389425 3300042620 Bacteria 1838
117 Ga0466728_457640 3300042620 Bacteria 4415
118 Ga0123357_10413315 3300009784 Bacteria 1213
119 Ga0123353_10000986 3300010167 Bacteria 34908
120 Ga0466707_007575 3300042601 Bacteria 1883
121 Ga0466707_273838 3300042601 Bacteria 2150
122 Ga0466707_412748 3300042601 Bacteria 12974
123 Ga0466713_139351 3300042602 Bacteria 1697
124 Ga0466719_259906 3300042606 Bacteria 7429
125 JGI24702J35022_10133660 3300002462 Bacteria 1379
126 JGI24700J35501_10930754 3300002508 Bacteria 21900
127 Ga0466730_015592 3300042625 Bacteria 2584
128 Ga0466709_136945 3300042648 Bacteria 18039
129 Ga0466708_220235 3300042652 Bacteria 14360
130 Ga0466705_309032 3300042612 Bacteria 2237
131 Ga0466690_132540 3300042590 Bacteria 1738
132 Ga0466692_075675 3300042591 Bacteria 36211
133 Ga0466696_308680 3300042596 Bacteria 10572
134 Ga0466711_156755 3300042615 Bacteria 4552
135 Ga0466711_449178 3300042615 Bacteria 1423
136 Ga0466715_395209 3300042616 Bacteria 9056
137 Ga0466723_004962 3300042618 Bacteria 19056
138 Ga0466723_358476 3300042618 Bacteria 3512
139 Ga0466723_367039 3300042618 Bacteria 6805
140 Ga0466726_096969 3300042619 Bacteria 1347
141 Ga0123357_10124849 3300009784 Bacteria 3228
142 Ga0123355_10006741 3300009826 Bacteria 17091
143 Ga0123356_10014741 3300010049 Bacteria 7509
144 Ga0123353_10128062 3300010167 Bacteria 4077
145 Ga0466707_088240 3300042601 Bacteria 2019
146 Ga0466719_053582 3300042606 Bacteria 1153
147 Ga0466719_101890 3300042606 Bacteria 1482
148 Ga0466719_119968 3300042606 Bacteria 20560
149 Ga0466722_030158 3300042609 Bacteria 8170
150 2227655171 2225789004 Bacteria 10680
151 Ga0068305_10014258 3300005083 Unclassified 5084
152 Ga0466729_201810 3300042621 Bacteria 5046
153 Ga0466731_258617 3300042622 Bacteria 1522
154 Ga0466704_032956 3300042643 Bacteria 6239
155 Ga0466704_218731 3300042643 Bacteria 3140
156 Ga0466709_126112 3300042648 Bacteria 3691
157 Ga0466708_042671 3300042652 Bacteria 4781
158 Ga0466690_291823 3300042590 Bacteria 1398
159 Ga0466691_106423 3300042593 Bacteria 5958
160 Ga0466691_227385 3300042593 Bacteria 9861
161 Ga0466699_129500 3300042597 Bacteria 1411
162 Ga0466705_503916 3300042612 Bacteria 9256
163 Ga0466712_039052 3300042614 Bacteria 4779
164 Ga0466711_050808 3300042615 Bacteria 1945
165 Ga0466715_269665 3300042616 Bacteria 14613
166 Ga0466723_172604 3300042618 Bacteria 6876
167 Ga0466726_462977 3300042619 Bacteria 1354
168 Ga0466728_035827 3300042620 Bacteria 3009
169 Ga0466729_189752 3300042621 Bacteria 1327
170 Ga0123353_10002413 3300010167 Bacteria 23222
171 Ga0123353_10068154 3300010167 Bacteria 5713
172 Ga0123353_10171510 3300010167 Bacteria 3443
173 Ga0123354_10016977 3300010882 Bacteria 11402
174 Ga0466707_046513 3300042601 Bacteria 1058
175 Ga0466719_017343 3300042606 Bacteria 4108
176 IMNBL1DRAFT_c0000497 3300000062 Bacteria 32820
177 IMNBL1DRAFT_c0007850 3300000062 Bacteria 5535
178 Ga0466729_296844 3300042621 Bacteria 1294
179 Ga0466735_051175 3300042624 Bacteria 3066
180 Ga0466735_103751 3300042624 Bacteria 1808
181 Ga0466703_065803 3300042636 Bacteria 8199
182 Ga0466703_070657 3300042636 Bacteria 11988
183 Ga0466703_273974 3300042636 Bacteria 93063
184 Ga0466704_121571 3300042643 Bacteria 4402
185 Ga0466704_461357 3300042643 Bacteria 2012
186 Ga0466708_181832 3300042652 Bacteria 35126
187 Ga0466705_067459 3300042612 Bacteria 11793
188 Ga0466705_378867 3300042612 Bacteria 3213
189 Ga0160468_100135 3300012819 Bacteria 70290
190 Ga0466690_001834 3300042590 Bacteria 3219
191 Ga0466690_190907 3300042590 Bacteria 27269
192 Ga0466690_328889 3300042590 Bacteria 1992
193 Ga0466692_195112 3300042591 Bacteria 3978
194 Ga0466696_470846 3300042596 Bacteria 2100
195 Ga0466705_512137 3300042612 Bacteria 1922
196 Ga0466711_248645 3300042615 Bacteria 6148
197 Ga0466711_410139 3300042615 Bacteria 2032
198 Ga0466715_243306 3300042616 Bacteria 1528
199 Ga0466723_047931 3300042618 Bacteria 55036
200 Ga0466726_192261 3300042619 Bacteria 3641
201 Ga0466728_220569 3300042620 Bacteria 1859
202 Ga0123356_10292955 3300010049 Bacteria 1729
203 Ga0123353_10015257 3300010167 Bacteria 11145
204 Ga0123353_10070322 3300010167 Bacteria 5623
205 Ga0123353_10382746 3300010167 Bacteria 2103
206 Ga0466700_479662 3300042600 Bacteria 2456
207 Ga0466716_318980 3300042605 Bacteria 3683
208 Ga0466719_023107 3300042606 Bacteria 14957
209 Ga0466722_067487 3300042609 Bacteria 2521
210 Ga0466722_070491 3300042609 Bacteria 2169
211 Ga0466722_071186 3300042609 Bacteria 3884
212 2227219674 2225789004 Bacteria 33696
213 JGI24702J35022_10002711 3300002462 Bacteria 10751
214 Ga0466704_390677 3300042643 Bacteria 5111
215 Ga0466709_221025 3300042648 Bacteria 1581
216 Ga0466709_260470 3300042648 Bacteria 12756
217 Ga0466727_124852 3300042655 Bacteria 1761
218 Ga0466705_002164 3300042612 Bacteria 13974
219 Ga0160445_100491 3300012847 Bacteria 19562
220 Ga0160445_108272 3300012847 Bacteria 1610
221 Ga0466694_273546 3300042594 Bacteria 1357
222 Ga0466699_038596 3300042597 Bacteria 11155
223 Ga0466699_439736 3300042597 Bacteria 1149
224 Ga0466705_427427 3300042612 Bacteria 12446
225 Ga0466705_448218 3300042612 Bacteria 4073
226 Ga0466711_109736 3300042615 Bacteria 3431
227 Ga0466715_241470 3300042616 Bacteria 12610
228 Ga0466715_300452 3300042616 Bacteria 2816
229 Ga0466715_341438 3300042616 Bacteria 7510
230 Ga0466715_457086 3300042616 Bacteria 6847
231 Ga0466715_645404 3300042616 Bacteria 2379
232 Ga0466723_104149 3300042618 Bacteria 1331
233 Ga0466723_274986 3300042618 Bacteria 6378
234 Ga0466723_275075 3300042618 Bacteria 2220
235 Ga0466728_118571 3300042620 Bacteria 3472
236 Ga0123355_10402268 3300009826 Bacteria 1765
237 Ga0123353_10011427 3300010167 Bacteria 12513
238 Ga0123353_10197212 3300010167 Bacteria 3172
239 Ga0123353_10487343 3300010167 Bacteria 1802
240 Ga0123354_10140222 3300010882 Bacteria 2996
241 Ga0466719_034786 3300042606 Bacteria 2370
242 Ga0466719_471858 3300042606 Bacteria 1661
243 IMNBL1DRAFT_c0000054 3300000062 Bacteria 108620
244 Ga0466703_121264 3300042636 Bacteria 3426
245 Ga0466703_137400 3300042636 Bacteria 7785
246 Ga0466704_194810 3300042643 Bacteria 3855
247 Ga0466708_307704 3300042652 Bacteria 4186
248 Ga0466727_345583 3300042655 Bacteria 1848

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00389 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain 73 366 0.97
PF02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain 156 335 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02826 GO:0051287 NAD binding MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.