Protein Family IF09514
Metagenome
Isolate
272
Members
79
Samples
248
Scaffolds
320.81
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_461357|Ga0466704_461357_138_1241
- Length
- 367 aa
- Sequence
- LYHFIARPRKIKQFPGEGFLIKVPEQSGRRCGLALAPFAPTTKEVAMKIVILDGYAENPGDLSWDALAELAGADALTVHDRTPAGQVAGRIGPAEIVLTNKTPISRADMEACPNLRYIGMLATGYNVVDAAAAAERGIPLCNIPTYGTTSVSQHTIALLLEVCHRAGHHSRAVHEGRWAGAPDWCFWDYPQIELSGKTMGVFGFGRIGQATGRIARAQGMEVIAYNRSHSRHGSDSASYVELDEFWPRADIIALHSPLFPELEGLINKDTISRMKDGVIIVNTARGQLINEADLAGALNSGKVYGAGLDVVSVEPIRPDNPLLGAKNCIITPHIAWSSLESRKRLMDTAVENLHAFLDGKPINVVNM
Sample Types
Isolate
8.8%
Metagenome
91.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.9%
Unclassified
22.4%
Kalotermitidae
18.4%
Rhinotermitidae
5.3%
Armadillidiidae
3.9%
Curculionidae
3.9%
Termopsidae
3.9%
Passalidae
2.6%
Blaberidae
1.3%
Scarabaeidae
1.3%
Culicidae
1.3%
Hodotermitidae
1.3%
Formicidae
1.3%
Taxonomy
Archaea
2
Bacteria
262
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 13 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 16 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 17 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 22 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 23 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 29 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 30 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 31 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 32 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 33 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 34 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 35 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 36 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 37 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 38 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 39 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 40 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 43 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 44 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 45 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 46 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 47 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 48 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 49 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 50 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 51 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 52 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 53 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 54 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 55 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 56 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 57 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 58 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 59 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 60 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 61 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 62 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 63 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 64 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 65 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 66 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 67 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 68 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 69 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 70 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 71 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 72 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 73 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 74 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 75 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 76 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 77 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 78 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 79 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_133071 | 3300042612 | Bacteria | 1584 |
| 2 | Ga0466705_205909 | 3300042612 | Bacteria | 3410 |
| 3 | Ga0466705_275779 | 3300042612 | Bacteria | 7832 |
| 4 | Ga0466732_295235 | 3300042656 | Bacteria | 1961 |
| 5 | Ga0415639_080134 | 3300038395 | Bacteria | 4754 |
| 6 | Ga0466691_143649 | 3300042593 | Archaea | 3526 |
| 7 | Ga0466694_019748 | 3300042594 | Bacteria | 8777 |
| 8 | Ga0466695_328074 | 3300042595 | Bacteria | 2092 |
| 9 | Ga0466696_407833 | 3300042596 | Bacteria | 8617 |
| 10 | Ga0466699_227909 | 3300042597 | Bacteria | 2486 |
| 11 | Ga0466705_394981 | 3300042612 | Bacteria | 4157 |
| 12 | Ga0466711_099434 | 3300042615 | Bacteria | 7658 |
| 13 | Ga0466711_436936 | 3300042615 | Bacteria | 1793 |
| 14 | Ga0466715_195853 | 3300042616 | Bacteria | 12592 |
| 15 | Ga0466715_384954 | 3300042616 | Bacteria | 3091 |
| 16 | Ga0466715_536981 | 3300042616 | Bacteria | 36332 |
| 17 | Ga0466723_313594 | 3300042618 | Bacteria | 97104 |
| 18 | Ga0466726_468728 | 3300042619 | Bacteria | 5100 |
| 19 | Ga0123353_10021970 | 3300010167 | Bacteria | 9598 |
| 20 | Ga0123353_10333548 | 3300010167 | Bacteria | 2294 |
| 21 | Ga0466713_131676 | 3300042602 | Bacteria | 30987 |
| 22 | Ga0466719_107289 | 3300042606 | Bacteria | 2128 |
| 23 | Ga0466719_456709 | 3300042606 | Bacteria | 2308 |
| 24 | Ga0466719_504476 | 3300042606 | Unclassified | 2176 |
| 25 | Ga0466722_013685 | 3300042609 | Bacteria | 3390 |
| 26 | Ga0466722_036985 | 3300042609 | Bacteria | 64137 |
| 27 | Ga0466722_051555 | 3300042609 | Bacteria | 1321 |
| 28 | Ga0466722_080909 | 3300042609 | Bacteria | 4034 |
| 29 | JGI24698J34947_10000486 | 3300002449 | Bacteria | 18665 |
| 30 | JGI24695J34938_10088586 | 3300002450 | Bacteria | 1271 |
| 31 | JGI24702J35022_10007173 | 3300002462 | Bacteria | 6405 |
| 32 | JGI24702J35022_10134535 | 3300002462 | Bacteria | 1374 |
| 33 | JGI24702J35022_10142684 | 3300002462 | Bacteria | 1338 |
| 34 | Ga0466729_232590 | 3300042621 | Bacteria | 2731 |
| 35 | Ga0466735_092839 | 3300042624 | Unclassified | 3603 |
| 36 | Ga0466703_344825 | 3300042636 | Bacteria | 9564 |
| 37 | Ga0466704_157119 | 3300042643 | Bacteria | 14318 |
| 38 | Ga0466704_308416 | 3300042643 | Bacteria | 20776 |
| 39 | Ga0466709_337099 | 3300042648 | Bacteria | 8028 |
| 40 | Ga0466724_16530 | 3300042649 | Bacteria | 4490 |
| 41 | Ga0466708_202981 | 3300042652 | Bacteria | 3258 |
| 42 | Ga0466708_267514 | 3300042652 | Bacteria | 41870 |
| 43 | Ga0466727_081927 | 3300042655 | Bacteria | 40056 |
| 44 | Ga0466697_187322 | 3300042611 | Bacteria | 2247 |
| 45 | Ga0466705_022437 | 3300042612 | Bacteria | 24966 |
| 46 | Ga0466705_030668 | 3300042612 | Bacteria | 1792 |
| 47 | Ga0466727_351338 | 3300042655 | Bacteria | 3154 |
| 48 | Ga0466732_107391 | 3300042656 | Bacteria | 1451 |
| 49 | Ga0160433_100299 | 3300012846 | Bacteria | 32102 |
| 50 | Ga0415639_082739 | 3300038395 | Bacteria | 3225 |
| 51 | Ga0466690_026381 | 3300042590 | Bacteria | 5546 |
| 52 | Ga0466691_023429 | 3300042593 | Bacteria | 3482 |
| 53 | Ga0466691_100450 | 3300042593 | Bacteria | 4630 |
| 54 | Ga0466696_241566 | 3300042596 | Bacteria | 9952 |
| 55 | Ga0466715_200032 | 3300042616 | Bacteria | 4524 |
| 56 | Ga0466718_132896 | 3300042617 | Bacteria | 5812 |
| 57 | Ga0466723_096115 | 3300042618 | Bacteria | 3884 |
| 58 | Ga0466723_206154 | 3300042618 | Bacteria | 11370 |
| 59 | Ga0123355_10002747 | 3300009826 | Bacteria | 24950 |
| 60 | Ga0123353_10013433 | 3300010167 | Bacteria | 11730 |
| 61 | Ga0466706_099508 | 3300042599 | Unclassified | 3005 |
| 62 | Ga0466706_136685 | 3300042599 | Bacteria | 3146 |
| 63 | Ga0466707_151783 | 3300042601 | Bacteria | 10732 |
| 64 | Ga0466707_194382 | 3300042601 | Bacteria | 2854 |
| 65 | Ga0466707_277588 | 3300042601 | Bacteria | 1574 |
| 66 | Ga0466716_154736 | 3300042605 | Bacteria | 1305 |
| 67 | Ga0466716_429330 | 3300042605 | Bacteria | 4371 |
| 68 | Ga0466722_170370 | 3300042609 | Bacteria | 5968 |
| 69 | Ga0123357_10000140 | 3300009784 | Bacteria | 63300 |
| 70 | Ga0466708_163365 | 3300042652 | Bacteria | 10909 |
| 71 | Ga0466708_464475 | 3300042652 | Bacteria | 69222 |
| 72 | Ga0466697_258400 | 3300042611 | Bacteria | 3054 |
| 73 | Ga0316159_10022 | 3300030930 | Bacteria | 39928 |
| 74 | Ga0466696_214238 | 3300042596 | Bacteria | 1488 |
| 75 | Ga0466705_434898 | 3300042612 | Bacteria | 1799 |
| 76 | Ga0466705_450040 | 3300042612 | Bacteria | 3119 |
| 77 | Ga0466711_183350 | 3300042615 | Bacteria | 47393 |
| 78 | Ga0466715_269477 | 3300042616 | Bacteria | 5228 |
| 79 | Ga0466715_437797 | 3300042616 | Bacteria | 6921 |
| 80 | Ga0466715_541370 | 3300042616 | Bacteria | 1685 |
| 81 | Ga0466723_259949 | 3300042618 | Bacteria | 9498 |
| 82 | Ga0466726_283918 | 3300042619 | Bacteria | 1741 |
| 83 | Ga0466728_208329 | 3300042620 | Bacteria | 3073 |
| 84 | Ga0123355_10116697 | 3300009826 | Bacteria | 4152 |
| 85 | Ga0123355_10439260 | 3300009826 | Bacteria | 1653 |
| 86 | Ga0123353_10267796 | 3300010167 | Bacteria | 2634 |
| 87 | Ga0123353_10480558 | 3300010167 | Bacteria | 1818 |
| 88 | Ga0123353_10679953 | 3300010167 | Bacteria | 1450 |
| 89 | Ga0123354_10315969 | 3300010882 | Bacteria | 1450 |
| 90 | Ga0466706_113497 | 3300042599 | Unclassified | 1814 |
| 91 | Ga0466707_214002 | 3300042601 | Bacteria | 3613 |
| 92 | Ga0466713_007759 | 3300042602 | Bacteria | 7851 |
| 93 | Ga0466713_017118 | 3300042602 | Unclassified | 23167 |
| 94 | Ga0466713_126765 | 3300042602 | Bacteria | 2614 |
| 95 | Ga0466714_032896 | 3300042603 | Bacteria | 2914 |
| 96 | Ga0466719_148721 | 3300042606 | Bacteria | 1277 |
| 97 | Ga0466719_322532 | 3300042606 | Bacteria | 1302 |
| 98 | JGI24705J35276_12181108 | 3300002504 | Bacteria | 1369 |
| 99 | Ga0466704_102481 | 3300042643 | Bacteria | 49033 |
| 100 | Ga0466704_155123 | 3300042643 | Bacteria | 1141 |
| 101 | Ga0466704_217881 | 3300042643 | Unclassified | 11193 |
| 102 | Ga0466704_230609 | 3300042643 | Bacteria | 2681 |
| 103 | Ga0466708_286021 | 3300042652 | Archaea | 6053 |
| 104 | Ga0466725_104632 | 3300042654 | Unclassified | 2413 |
| 105 | Ga0466727_079716 | 3300042655 | Bacteria | 8828 |
| 106 | Ga0160445_101691 | 3300012847 | Bacteria | 5858 |
| 107 | Ga0264413_141055 | 3300024493 | Bacteria | 8336 |
| 108 | Ga0466690_114337 | 3300042590 | Bacteria | 3564 |
| 109 | Ga0466690_159038 | 3300042590 | Bacteria | 2763 |
| 110 | Ga0466694_116468 | 3300042594 | Bacteria | 4589 |
| 111 | Ga0466694_329784 | 3300042594 | Bacteria | 4670 |
| 112 | Ga0466694_366070 | 3300042594 | Bacteria | 1281 |
| 113 | Ga0466715_088835 | 3300042616 | Bacteria | 19594 |
| 114 | Ga0466715_182470 | 3300042616 | Bacteria | 7184 |
| 115 | Ga0466715_189306 | 3300042616 | Bacteria | 3018 |
| 116 | Ga0466728_389425 | 3300042620 | Bacteria | 1838 |
| 117 | Ga0466728_457640 | 3300042620 | Bacteria | 4415 |
| 118 | Ga0123357_10413315 | 3300009784 | Bacteria | 1213 |
| 119 | Ga0123353_10000986 | 3300010167 | Bacteria | 34908 |
| 120 | Ga0466707_007575 | 3300042601 | Bacteria | 1883 |
| 121 | Ga0466707_273838 | 3300042601 | Bacteria | 2150 |
| 122 | Ga0466707_412748 | 3300042601 | Bacteria | 12974 |
| 123 | Ga0466713_139351 | 3300042602 | Bacteria | 1697 |
| 124 | Ga0466719_259906 | 3300042606 | Bacteria | 7429 |
| 125 | JGI24702J35022_10133660 | 3300002462 | Bacteria | 1379 |
| 126 | JGI24700J35501_10930754 | 3300002508 | Bacteria | 21900 |
| 127 | Ga0466730_015592 | 3300042625 | Bacteria | 2584 |
| 128 | Ga0466709_136945 | 3300042648 | Bacteria | 18039 |
| 129 | Ga0466708_220235 | 3300042652 | Bacteria | 14360 |
| 130 | Ga0466705_309032 | 3300042612 | Bacteria | 2237 |
| 131 | Ga0466690_132540 | 3300042590 | Bacteria | 1738 |
| 132 | Ga0466692_075675 | 3300042591 | Bacteria | 36211 |
| 133 | Ga0466696_308680 | 3300042596 | Bacteria | 10572 |
| 134 | Ga0466711_156755 | 3300042615 | Bacteria | 4552 |
| 135 | Ga0466711_449178 | 3300042615 | Bacteria | 1423 |
| 136 | Ga0466715_395209 | 3300042616 | Bacteria | 9056 |
| 137 | Ga0466723_004962 | 3300042618 | Bacteria | 19056 |
| 138 | Ga0466723_358476 | 3300042618 | Bacteria | 3512 |
| 139 | Ga0466723_367039 | 3300042618 | Bacteria | 6805 |
| 140 | Ga0466726_096969 | 3300042619 | Bacteria | 1347 |
| 141 | Ga0123357_10124849 | 3300009784 | Bacteria | 3228 |
| 142 | Ga0123355_10006741 | 3300009826 | Bacteria | 17091 |
| 143 | Ga0123356_10014741 | 3300010049 | Bacteria | 7509 |
| 144 | Ga0123353_10128062 | 3300010167 | Bacteria | 4077 |
| 145 | Ga0466707_088240 | 3300042601 | Bacteria | 2019 |
| 146 | Ga0466719_053582 | 3300042606 | Bacteria | 1153 |
| 147 | Ga0466719_101890 | 3300042606 | Bacteria | 1482 |
| 148 | Ga0466719_119968 | 3300042606 | Bacteria | 20560 |
| 149 | Ga0466722_030158 | 3300042609 | Bacteria | 8170 |
| 150 | 2227655171 | 2225789004 | Bacteria | 10680 |
| 151 | Ga0068305_10014258 | 3300005083 | Unclassified | 5084 |
| 152 | Ga0466729_201810 | 3300042621 | Bacteria | 5046 |
| 153 | Ga0466731_258617 | 3300042622 | Bacteria | 1522 |
| 154 | Ga0466704_032956 | 3300042643 | Bacteria | 6239 |
| 155 | Ga0466704_218731 | 3300042643 | Bacteria | 3140 |
| 156 | Ga0466709_126112 | 3300042648 | Bacteria | 3691 |
| 157 | Ga0466708_042671 | 3300042652 | Bacteria | 4781 |
| 158 | Ga0466690_291823 | 3300042590 | Bacteria | 1398 |
| 159 | Ga0466691_106423 | 3300042593 | Bacteria | 5958 |
| 160 | Ga0466691_227385 | 3300042593 | Bacteria | 9861 |
| 161 | Ga0466699_129500 | 3300042597 | Bacteria | 1411 |
| 162 | Ga0466705_503916 | 3300042612 | Bacteria | 9256 |
| 163 | Ga0466712_039052 | 3300042614 | Bacteria | 4779 |
| 164 | Ga0466711_050808 | 3300042615 | Bacteria | 1945 |
| 165 | Ga0466715_269665 | 3300042616 | Bacteria | 14613 |
| 166 | Ga0466723_172604 | 3300042618 | Bacteria | 6876 |
| 167 | Ga0466726_462977 | 3300042619 | Bacteria | 1354 |
| 168 | Ga0466728_035827 | 3300042620 | Bacteria | 3009 |
| 169 | Ga0466729_189752 | 3300042621 | Bacteria | 1327 |
| 170 | Ga0123353_10002413 | 3300010167 | Bacteria | 23222 |
| 171 | Ga0123353_10068154 | 3300010167 | Bacteria | 5713 |
| 172 | Ga0123353_10171510 | 3300010167 | Bacteria | 3443 |
| 173 | Ga0123354_10016977 | 3300010882 | Bacteria | 11402 |
| 174 | Ga0466707_046513 | 3300042601 | Bacteria | 1058 |
| 175 | Ga0466719_017343 | 3300042606 | Bacteria | 4108 |
| 176 | IMNBL1DRAFT_c0000497 | 3300000062 | Bacteria | 32820 |
| 177 | IMNBL1DRAFT_c0007850 | 3300000062 | Bacteria | 5535 |
| 178 | Ga0466729_296844 | 3300042621 | Bacteria | 1294 |
| 179 | Ga0466735_051175 | 3300042624 | Bacteria | 3066 |
| 180 | Ga0466735_103751 | 3300042624 | Bacteria | 1808 |
| 181 | Ga0466703_065803 | 3300042636 | Bacteria | 8199 |
| 182 | Ga0466703_070657 | 3300042636 | Bacteria | 11988 |
| 183 | Ga0466703_273974 | 3300042636 | Bacteria | 93063 |
| 184 | Ga0466704_121571 | 3300042643 | Bacteria | 4402 |
| 185 | Ga0466704_461357 | 3300042643 | Bacteria | 2012 |
| 186 | Ga0466708_181832 | 3300042652 | Bacteria | 35126 |
| 187 | Ga0466705_067459 | 3300042612 | Bacteria | 11793 |
| 188 | Ga0466705_378867 | 3300042612 | Bacteria | 3213 |
| 189 | Ga0160468_100135 | 3300012819 | Bacteria | 70290 |
| 190 | Ga0466690_001834 | 3300042590 | Bacteria | 3219 |
| 191 | Ga0466690_190907 | 3300042590 | Bacteria | 27269 |
| 192 | Ga0466690_328889 | 3300042590 | Bacteria | 1992 |
| 193 | Ga0466692_195112 | 3300042591 | Bacteria | 3978 |
| 194 | Ga0466696_470846 | 3300042596 | Bacteria | 2100 |
| 195 | Ga0466705_512137 | 3300042612 | Bacteria | 1922 |
| 196 | Ga0466711_248645 | 3300042615 | Bacteria | 6148 |
| 197 | Ga0466711_410139 | 3300042615 | Bacteria | 2032 |
| 198 | Ga0466715_243306 | 3300042616 | Bacteria | 1528 |
| 199 | Ga0466723_047931 | 3300042618 | Bacteria | 55036 |
| 200 | Ga0466726_192261 | 3300042619 | Bacteria | 3641 |
| 201 | Ga0466728_220569 | 3300042620 | Bacteria | 1859 |
| 202 | Ga0123356_10292955 | 3300010049 | Bacteria | 1729 |
| 203 | Ga0123353_10015257 | 3300010167 | Bacteria | 11145 |
| 204 | Ga0123353_10070322 | 3300010167 | Bacteria | 5623 |
| 205 | Ga0123353_10382746 | 3300010167 | Bacteria | 2103 |
| 206 | Ga0466700_479662 | 3300042600 | Bacteria | 2456 |
| 207 | Ga0466716_318980 | 3300042605 | Bacteria | 3683 |
| 208 | Ga0466719_023107 | 3300042606 | Bacteria | 14957 |
| 209 | Ga0466722_067487 | 3300042609 | Bacteria | 2521 |
| 210 | Ga0466722_070491 | 3300042609 | Bacteria | 2169 |
| 211 | Ga0466722_071186 | 3300042609 | Bacteria | 3884 |
| 212 | 2227219674 | 2225789004 | Bacteria | 33696 |
| 213 | JGI24702J35022_10002711 | 3300002462 | Bacteria | 10751 |
| 214 | Ga0466704_390677 | 3300042643 | Bacteria | 5111 |
| 215 | Ga0466709_221025 | 3300042648 | Bacteria | 1581 |
| 216 | Ga0466709_260470 | 3300042648 | Bacteria | 12756 |
| 217 | Ga0466727_124852 | 3300042655 | Bacteria | 1761 |
| 218 | Ga0466705_002164 | 3300042612 | Bacteria | 13974 |
| 219 | Ga0160445_100491 | 3300012847 | Bacteria | 19562 |
| 220 | Ga0160445_108272 | 3300012847 | Bacteria | 1610 |
| 221 | Ga0466694_273546 | 3300042594 | Bacteria | 1357 |
| 222 | Ga0466699_038596 | 3300042597 | Bacteria | 11155 |
| 223 | Ga0466699_439736 | 3300042597 | Bacteria | 1149 |
| 224 | Ga0466705_427427 | 3300042612 | Bacteria | 12446 |
| 225 | Ga0466705_448218 | 3300042612 | Bacteria | 4073 |
| 226 | Ga0466711_109736 | 3300042615 | Bacteria | 3431 |
| 227 | Ga0466715_241470 | 3300042616 | Bacteria | 12610 |
| 228 | Ga0466715_300452 | 3300042616 | Bacteria | 2816 |
| 229 | Ga0466715_341438 | 3300042616 | Bacteria | 7510 |
| 230 | Ga0466715_457086 | 3300042616 | Bacteria | 6847 |
| 231 | Ga0466715_645404 | 3300042616 | Bacteria | 2379 |
| 232 | Ga0466723_104149 | 3300042618 | Bacteria | 1331 |
| 233 | Ga0466723_274986 | 3300042618 | Bacteria | 6378 |
| 234 | Ga0466723_275075 | 3300042618 | Bacteria | 2220 |
| 235 | Ga0466728_118571 | 3300042620 | Bacteria | 3472 |
| 236 | Ga0123355_10402268 | 3300009826 | Bacteria | 1765 |
| 237 | Ga0123353_10011427 | 3300010167 | Bacteria | 12513 |
| 238 | Ga0123353_10197212 | 3300010167 | Bacteria | 3172 |
| 239 | Ga0123353_10487343 | 3300010167 | Bacteria | 1802 |
| 240 | Ga0123354_10140222 | 3300010882 | Bacteria | 2996 |
| 241 | Ga0466719_034786 | 3300042606 | Bacteria | 2370 |
| 242 | Ga0466719_471858 | 3300042606 | Bacteria | 1661 |
| 243 | IMNBL1DRAFT_c0000054 | 3300000062 | Bacteria | 108620 |
| 244 | Ga0466703_121264 | 3300042636 | Bacteria | 3426 |
| 245 | Ga0466703_137400 | 3300042636 | Bacteria | 7785 |
| 246 | Ga0466704_194810 | 3300042643 | Bacteria | 3855 |
| 247 | Ga0466708_307704 | 3300042652 | Bacteria | 4186 |
| 248 | Ga0466727_345583 | 3300042655 | Bacteria | 1848 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02826 | GO:0051287 | NAD binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.