Protein Family IF09487
Metagenome
Isolate
208
Members
74
Samples
177
Scaffolds
458.07
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_363108|Ga0466704_363108_22132_23619
- Length
- 495 aa
- Sequence
- MNDNMTKPVPYFKIKAGIRFVLHSICPIFGNELKLYLMFSKETYMDRRTSLKKAIGSGLLLFSGNDEAGCNYAGNTYPYRQDSTFLYFFGQPYAGLSAVIDIDDDREIIFGDEPTMDDIIWMGTQPTLREKCAFAGISELMPAGAVTDFLQKARQKGRAVHYLPSYRPEHKLTLWKRLGVLPDEEKSSADFIRAVVNLRNYKSDEEVAEIEKACLVTADMHLAAMRAIRPGIHEYEVVAAIESVAGARNCALSFPVIATVNGQTLHNHYHGNPVKSGDLFLVDAGAETAACYAGDMSSTTPADHRFTAWQADIYRIQTAMHDQSVEALRPGIAFEEVYDISARVMIEGLKGLGLMRGDTEEALASGAYALFYPHGLGHMMGLDVHDMENLGEVYVGYDGRPKSKQFGRASLRLGRVLEPGFVHTIEPGVYFIPELIDQWKAENKYPGFINYEKLEACKSFGGIRNEEDYLITETGARLLGKRIPRTVEEVEAFRD
Sample Types
Isolate
14.9%
Metagenome
85.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.1%
Termitidae
19.2%
Kalotermitidae
19.2%
Unclassified
13.7%
Rhinotermitidae
6.8%
Termopsidae
5.5%
Passalidae
4.1%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 2 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 9 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 10 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 11 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 12 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 13 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 27 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 28 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 29 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 30 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 31 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 32 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 39 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 42 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 43 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 44 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 45 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 51 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 52 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 59 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 60 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 61 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 62 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 63 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 64 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 65 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 66 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 67 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 68 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 69 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 70 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 71 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 72 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 73 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_032068 | 3300042591 | Bacteria | 25323 |
| 2 | Ga0466696_151297 | 3300042596 | Bacteria | 6433 |
| 3 | Ga0466696_225714 | 3300042596 | Bacteria | 9490 |
| 4 | Ga0466696_329102 | 3300042596 | Bacteria | 26774 |
| 5 | Ga0466705_080971 | 3300042612 | Bacteria | 12545 |
| 6 | Ga0466708_089052 | 3300042652 | Bacteria | 19306 |
| 7 | Ga0466725_056801 | 3300042654 | Bacteria | 12353 |
| 8 | Ga0466711_006210 | 3300042615 | Bacteria | 3932 |
| 9 | Ga0466711_015248 | 3300042615 | Bacteria | 5152 |
| 10 | Ga0466711_071376 | 3300042615 | Bacteria | 34883 |
| 11 | Ga0466711_083950 | 3300042615 | Unclassified | 2395 |
| 12 | Ga0466715_041831 | 3300042616 | Bacteria | 3617 |
| 13 | Ga0466715_137784 | 3300042616 | Bacteria | 9423 |
| 14 | Ga0466715_208106 | 3300042616 | Bacteria | 46490 |
| 15 | Ga0466723_093570 | 3300042618 | Bacteria | 5757 |
| 16 | Ga0466723_175652 | 3300042618 | Bacteria | 41824 |
| 17 | Ga0466723_352875 | 3300042618 | Bacteria | 7056 |
| 18 | Ga0466706_082080 | 3300042599 | Bacteria | 38933 |
| 19 | Ga0466713_049043 | 3300042602 | Bacteria | 3827 |
| 20 | Ga0466719_231820 | 3300042606 | Bacteria | 2817 |
| 21 | Ga0068305_10023936 | 3300005083 | Bacteria | 16500 |
| 22 | Ga0466733_026963 | 3300042659 | Bacteria | 2086 |
| 23 | Ga0466733_194723 | 3300042659 | Bacteria | 4492 |
| 24 | Ga0466690_014891 | 3300042590 | Bacteria | 6996 |
| 25 | Ga0466690_273455 | 3300042590 | Bacteria | 11832 |
| 26 | Ga0466704_130597 | 3300042643 | Bacteria | 2549 |
| 27 | Ga0466704_169299 | 3300042643 | Bacteria | 16366 |
| 28 | Ga0466709_292381 | 3300042648 | Bacteria | 26299 |
| 29 | Ga0466727_089930 | 3300042655 | Bacteria | 5420 |
| 30 | Ga0466727_232308 | 3300042655 | Bacteria | 4037 |
| 31 | Ga0466711_118017 | 3300042615 | Bacteria | 3040 |
| 32 | Ga0466723_068280 | 3300042618 | Bacteria | 19935 |
| 33 | Ga0466728_288116 | 3300042620 | Bacteria | 7389 |
| 34 | Ga0466707_410798 | 3300042601 | Bacteria | 5211 |
| 35 | Ga0466713_073650 | 3300042602 | Bacteria | 22168 |
| 36 | Ga0466716_282690 | 3300042605 | Bacteria | 17125 |
| 37 | Ga0466716_386438 | 3300042605 | Bacteria | 23382 |
| 38 | Ga0466722_261229 | 3300042609 | Bacteria | 1978 |
| 39 | Ga0068302_10009782 | 3300005071 | Bacteria | 6256 |
| 40 | Ga0123355_10000036 | 3300009826 | Bacteria | 135537 |
| 41 | Ga0466692_082217 | 3300042591 | Bacteria | 9048 |
| 42 | Ga0466691_049845 | 3300042593 | Bacteria | 17289 |
| 43 | Ga0466691_144468 | 3300042593 | Bacteria | 18446 |
| 44 | Ga0466705_247067 | 3300042612 | Bacteria | 2051 |
| 45 | Ga0466729_216104 | 3300042621 | Bacteria | 8377 |
| 46 | Ga0466735_084109 | 3300042624 | Bacteria | 2030 |
| 47 | Ga0466727_076463 | 3300042655 | Bacteria | 19902 |
| 48 | Ga0466705_400119 | 3300042612 | Bacteria | 34089 |
| 49 | Ga0466711_141928 | 3300042615 | Bacteria | 17413 |
| 50 | Ga0466711_144282 | 3300042615 | Bacteria | 9623 |
| 51 | Ga0466715_484657 | 3300042616 | Bacteria | 16388 |
| 52 | Ga0466723_278235 | 3300042618 | Bacteria | 28103 |
| 53 | Ga0466706_015175 | 3300042599 | Bacteria | 5709 |
| 54 | Ga0466707_091194 | 3300042601 | Bacteria | 2445 |
| 55 | Ga0466714_071176 | 3300042603 | Bacteria | 1628 |
| 56 | Ga0466719_004035 | 3300042606 | Bacteria | 3276 |
| 57 | Ga0466722_139799 | 3300042609 | Bacteria | 2029 |
| 58 | 2227566295 | 2225789004 | Bacteria | 14226 |
| 59 | JGI24695J34938_10034973 | 3300002450 | Bacteria | 2301 |
| 60 | Ga0068305_10074363 | 3300005083 | Unclassified | 10836 |
| 61 | Ga0123353_10000929 | 3300010167 | Bacteria | 35796 |
| 62 | Ga0466656_031987 | 3300042550 | Bacteria | 4100 |
| 63 | Ga0466690_323146 | 3300042590 | Bacteria | 40006 |
| 64 | Ga0466690_325148 | 3300042590 | Bacteria | 13281 |
| 65 | Ga0466691_133192 | 3300042593 | Bacteria | 19840 |
| 66 | Ga0466696_088331 | 3300042596 | Bacteria | 38541 |
| 67 | Ga0466705_204903 | 3300042612 | Bacteria | 8303 |
| 68 | Ga0466735_025195 | 3300042624 | Bacteria | 6639 |
| 69 | Ga0466735_160098 | 3300042624 | Bacteria | 2475 |
| 70 | Ga0466703_376232 | 3300042636 | Bacteria | 2186 |
| 71 | Ga0466704_093118 | 3300042643 | Bacteria | 21105 |
| 72 | Ga0466712_162420 | 3300042614 | Bacteria | 2811 |
| 73 | Ga0466711_168100 | 3300042615 | Bacteria | 15409 |
| 74 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 75 | Ga0466726_384401 | 3300042619 | Bacteria | 4254 |
| 76 | Ga0466706_009507 | 3300042599 | Bacteria | 49149 |
| 77 | Ga0466706_134275 | 3300042599 | Bacteria | 1812 |
| 78 | Ga0466706_251693 | 3300042599 | Bacteria | 42498 |
| 79 | Ga0466716_178319 | 3300042605 | Bacteria | 2970 |
| 80 | Ga0466716_279234 | 3300042605 | Bacteria | 7813 |
| 81 | Ga0466719_030599 | 3300042606 | Bacteria | 14291 |
| 82 | 2227005373 | 2225789003 | Bacteria | 5777 |
| 83 | 2227108588 | 2225789004 | Bacteria | 37674 |
| 84 | Ga0466733_092876 | 3300042659 | Bacteria | 23009 |
| 85 | Ga0123356_10177578 | 3300010049 | Bacteria | 2148 |
| 86 | Ga0466656_224030 | 3300042550 | Bacteria | 11159 |
| 87 | Ga0466691_227930 | 3300042593 | Bacteria | 8490 |
| 88 | Ga0466703_047725 | 3300042636 | Bacteria | 13908 |
| 89 | Ga0466703_060494 | 3300042636 | Bacteria | 13418 |
| 90 | Ga0466703_087048 | 3300042636 | Bacteria | 8460 |
| 91 | Ga0466703_130712 | 3300042636 | Bacteria | 3819 |
| 92 | Ga0466703_349706 | 3300042636 | Bacteria | 2701 |
| 93 | Ga0466704_203482 | 3300042643 | Bacteria | 1742 |
| 94 | Ga0466709_307822 | 3300042648 | Bacteria | 161839 |
| 95 | Ga0466727_172499 | 3300042655 | Bacteria | 33707 |
| 96 | Ga0466711_176509 | 3300042615 | Bacteria | 3941 |
| 97 | Ga0466711_465049 | 3300042615 | Bacteria | 7689 |
| 98 | Ga0466715_330145 | 3300042616 | Bacteria | 25669 |
| 99 | Ga0466723_163674 | 3300042618 | Bacteria | 19967 |
| 100 | Ga0466726_362804 | 3300042619 | Bacteria | 3457 |
| 101 | Ga0466728_389311 | 3300042620 | Bacteria | 12570 |
| 102 | Ga0466706_007881 | 3300042599 | Bacteria | 5450 |
| 103 | Ga0466706_083922 | 3300042599 | Bacteria | 29703 |
| 104 | Ga0466706_276180 | 3300042599 | Bacteria | 65753 |
| 105 | Ga0466713_001786 | 3300042602 | Bacteria | 6561 |
| 106 | Ga0466713_052219 | 3300042602 | Bacteria | 69085 |
| 107 | JGI24702J35022_10024060 | 3300002462 | Bacteria | 3291 |
| 108 | Ga0068302_10235909 | 3300005071 | Unclassified | 4983 |
| 109 | Ga0068305_10002064 | 3300005083 | Bacteria | 156822 |
| 110 | Ga0466733_006567 | 3300042659 | Bacteria | 10919 |
| 111 | Ga0466690_135688 | 3300042590 | Bacteria | 8117 |
| 112 | Ga0466691_052399 | 3300042593 | Bacteria | 16626 |
| 113 | Ga0466696_259199 | 3300042596 | Bacteria | 9698 |
| 114 | Ga0466705_092074 | 3300042612 | Bacteria | 11963 |
| 115 | Ga0466705_193616 | 3300042612 | Bacteria | 42196 |
| 116 | Ga0466735_020563 | 3300042624 | Bacteria | 1243 |
| 117 | Ga0466735_116950 | 3300042624 | Bacteria | 7138 |
| 118 | Ga0466703_277371 | 3300042636 | Bacteria | 2061 |
| 119 | Ga0466703_426220 | 3300042636 | Bacteria | 39212 |
| 120 | Ga0466704_363108 | 3300042643 | Bacteria | 39184 |
| 121 | Ga0466708_386592 | 3300042652 | Bacteria | 14720 |
| 122 | Ga0466715_412841 | 3300042616 | Bacteria | 4217 |
| 123 | Ga0466728_412588 | 3300042620 | Bacteria | 41529 |
| 124 | Ga0466706_052074 | 3300042599 | Bacteria | 4954 |
| 125 | Ga0466706_151978 | 3300042599 | Bacteria | 59315 |
| 126 | Ga0466700_130979 | 3300042600 | Bacteria | 3153 |
| 127 | Ga0466700_391565 | 3300042600 | Bacteria | 10641 |
| 128 | Ga0466733_013758 | 3300042659 | Bacteria | 12063 |
| 129 | Ga0123353_10017545 | 3300010167 | Bacteria | 10529 |
| 130 | Ga0466691_168669 | 3300042593 | Bacteria | 22573 |
| 131 | Ga0466695_284703 | 3300042595 | Bacteria | 56309 |
| 132 | Ga0466735_103058 | 3300042624 | Bacteria | 2000 |
| 133 | Ga0466703_329220 | 3300042636 | Bacteria | 14638 |
| 134 | Ga0466708_054511 | 3300042652 | Bacteria | 38692 |
| 135 | Ga0466708_138224 | 3300042652 | Bacteria | 4475 |
| 136 | Ga0466727_289965 | 3300042655 | Bacteria | 4680 |
| 137 | Ga0466710_082511 | 3300042613 | Bacteria | 7723 |
| 138 | Ga0466715_157977 | 3300042616 | Bacteria | 113033 |
| 139 | Ga0466726_217472 | 3300042619 | Bacteria | 2125 |
| 140 | Ga0466726_364228 | 3300042619 | Bacteria | 7092 |
| 141 | Ga0466728_209710 | 3300042620 | Bacteria | 27061 |
| 142 | Ga0466706_119636 | 3300042599 | Bacteria | 24059 |
| 143 | Ga0466707_146028 | 3300042601 | Bacteria | 14106 |
| 144 | Ga0466713_105915 | 3300042602 | Bacteria | 69739 |
| 145 | Ga0466713_123054 | 3300042602 | Bacteria | 24516 |
| 146 | Ga0466716_321736 | 3300042605 | Bacteria | 1555 |
| 147 | Ga0466722_126170 | 3300042609 | Bacteria | 47921 |
| 148 | IMNBL1DRAFT_c0000308 | 3300000062 | Bacteria | 41637 |
| 149 | IMNBL1DRAFT_c0008106 | 3300000062 | Bacteria | 5405 |
| 150 | JGI24695J34938_10026136 | 3300002450 | Unclassified | 2778 |
| 151 | Ga0068305_10057279 | 3300005083 | Bacteria | 6661 |
| 152 | Ga0466733_137520 | 3300042659 | Bacteria | 11726 |
| 153 | Ga0466657_237884 | 3300042582 | Bacteria | 3012 |
| 154 | Ga0466690_012795 | 3300042590 | Bacteria | 12955 |
| 155 | Ga0466690_270417 | 3300042590 | Bacteria | 12377 |
| 156 | Ga0466690_343341 | 3300042590 | Bacteria | 7345 |
| 157 | Ga0466691_116256 | 3300042593 | Bacteria | 26253 |
| 158 | Ga0466696_021950 | 3300042596 | Bacteria | 5759 |
| 159 | Ga0466696_168682 | 3300042596 | Bacteria | 17271 |
| 160 | Ga0466705_358209 | 3300042612 | Bacteria | 6311 |
| 161 | Ga0466735_021601 | 3300042624 | Bacteria | 1733 |
| 162 | Ga0466735_223524 | 3300042624 | Bacteria | 3254 |
| 163 | Ga0466704_026770 | 3300042643 | Bacteria | 49720 |
| 164 | Ga0466704_103268 | 3300042643 | Bacteria | 23780 |
| 165 | Ga0466704_118870 | 3300042643 | Bacteria | 1862 |
| 166 | Ga0466708_125510 | 3300042652 | Bacteria | 1859 |
| 167 | Ga0466708_259782 | 3300042652 | Bacteria | 24929 |
| 168 | Ga0466715_165242 | 3300042616 | Bacteria | 12601 |
| 169 | Ga0466723_349603 | 3300042618 | Bacteria | 4944 |
| 170 | Ga0466726_431773 | 3300042619 | Bacteria | 2154 |
| 171 | Ga0466713_013071 | 3300042602 | Bacteria | 30342 |
| 172 | Ga0466713_053147 | 3300042602 | Bacteria | 18593 |
| 173 | Ga0466713_140837 | 3300042602 | Bacteria | 175760 |
| 174 | Ga0466716_417489 | 3300042605 | Bacteria | 27622 |
| 175 | Ga0068305_10088518 | 3300005083 | Bacteria | 8526 |
| 176 | Ga0068305_10097521 | 3300005083 | Bacteria | 3173 |
| 177 | Ga0072941_1294916 | 3300005201 | Bacteria | 3173 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.