Protein Family IF09449
Metagenome
Isolate
285
Members
69
Samples
265
Scaffolds
280.89
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_282944|Ga0466704_282944_9806_10831
- Length
- 341 aa
- Sequence
- MKDSGNIILRLFFNRTVSEIPASIKKNNLQTGKDVIPLGLFGNLATLRICMNGGKIVKIGVIGAGTMGSGIAQAFSVCAGYEVVLCDVNKDYAERGRAGIRAALDKLVEKGKMTRTAADAAAAAIHTGPNSAASDCGLVIEAVLENMDLKKEIFKELAEICGPDTIFATNTSSLSITELAACVKRPVVGMHFFNPAPVMKLVEVVAGLFTPPELVSRVSAIALDIGKTPVEVKDSAGFLVNRMLAPMVNEAAGILAEGLASAPDIDTAMKLGANHPMGPLALGDLIGLDVCLAVMEVLYSESGDPKYRPHPLLRKMVRGGLLGRKTGRGFFEYQAVDKKGC
Sample Types
Isolate
7.0%
Metagenome
93.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.8%
Unclassified
23.5%
Kalotermitidae
20.6%
Termopsidae
5.9%
Blattidae
5.9%
Passalidae
4.4%
Rhinotermitidae
2.9%
Stratiomyidae
1.5%
Hodotermitidae
1.5%
Taxonomy
Archaea
2
Bacteria
266
Eukaryota
0
Viruses
1
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 2 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 13 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 14 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 15 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 16 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 17 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 18 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 19 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 20 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 21 | 2820671341 | Unclassified Firmicutes Co191P3bin20 | Isolate | Unclassified |
| 22 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 36 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 37 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 38 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 39 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 40 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 41 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 42 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 43 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 44 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 55 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 56 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 57 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 58 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 59 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 60 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 61 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 62 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 63 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 64 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 67 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 69 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_237183 | 3300042616 | Bacteria | 3824 |
| 2 | Ga0466715_453341 | 3300042616 | Bacteria | 17062 |
| 3 | Ga0466726_204497 | 3300042619 | Bacteria | 2064 |
| 4 | Ga0466728_353722 | 3300042620 | Bacteria | 2981 |
| 5 | Ga0466690_307032 | 3300042590 | Bacteria | 2693 |
| 6 | Ga0466694_350528 | 3300042594 | Bacteria | 5528 |
| 7 | Ga0466699_437954 | 3300042597 | Bacteria | 1262 |
| 8 | Ga0466706_203124 | 3300042599 | Bacteria | 4552 |
| 9 | Ga0466713_119550 | 3300042602 | Bacteria | 166583 |
| 10 | Ga0466717_072050 | 3300042604 | Bacteria | 8222 |
| 11 | Ga0466719_076386 | 3300042606 | Bacteria | 2077 |
| 12 | Ga0123355_10000135 | 3300009826 | Bacteria | 86867 |
| 13 | Ga0123355_10010072 | 3300009826 | Bacteria | 14443 |
| 14 | Ga0123356_10004383 | 3300010049 | Bacteria | 14585 |
| 15 | Ga0123356_10054994 | 3300010049 | Bacteria | 3706 |
| 16 | Ga0123356_10075428 | 3300010049 | Bacteria | 3176 |
| 17 | Ga0123356_10213193 | 3300010049 | Bacteria | 1982 |
| 18 | Ga0123353_10065600 | 3300010167 | Bacteria | 5829 |
| 19 | Ga0123353_10563037 | 3300010167 | Bacteria | 1640 |
| 20 | Ga0123353_10612594 | 3300010167 | Bacteria | 1553 |
| 21 | Ga0123354_10149219 | 3300010882 | Bacteria | 2843 |
| 22 | IMNBL1DRAFT_c0000732 | 3300000062 | Bacteria | 26064 |
| 23 | JGI24702J35022_10013276 | 3300002462 | Unclassified | 4563 |
| 24 | JGI24702J35022_10042530 | 3300002462 | Bacteria | 2419 |
| 25 | JGI24699J35502_11130954 | 3300002509 | Bacteria | 5386 |
| 26 | Ga0068302_10014638 | 3300005071 | Bacteria | 3483 |
| 27 | Ga0466705_152719 | 3300042612 | Bacteria | 2314 |
| 28 | Ga0466729_225089 | 3300042621 | Bacteria | 4643 |
| 29 | Ga0466702_121259 | 3300042635 | Bacteria | 2196 |
| 30 | Ga0466703_180078 | 3300042636 | Bacteria | 1130 |
| 31 | Ga0466703_367353 | 3300042636 | Bacteria | 14222 |
| 32 | Ga0466703_424389 | 3300042636 | Unclassified | 1302 |
| 33 | Ga0466708_304126 | 3300042652 | Unclassified | 2078 |
| 34 | Ga0466727_002090 | 3300042655 | Bacteria | 2839 |
| 35 | Ga0466705_457154 | 3300042612 | Unclassified | 4660 |
| 36 | Ga0466705_472051 | 3300042612 | Unclassified | 2323 |
| 37 | Ga0466715_618207 | 3300042616 | Bacteria | 66197 |
| 38 | Ga0466718_012460 | 3300042617 | Bacteria | 2134 |
| 39 | Ga0466726_190151 | 3300042619 | Bacteria | 22711 |
| 40 | Ga0466691_081522 | 3300042593 | Bacteria | 5637 |
| 41 | Ga0466691_207275 | 3300042593 | Bacteria | 2944 |
| 42 | Ga0466707_009332 | 3300042601 | Bacteria | 2947 |
| 43 | Ga0466713_106006 | 3300042602 | Bacteria | 5970 |
| 44 | Ga0466714_006661 | 3300042603 | Bacteria | 2453 |
| 45 | Ga0466719_122833 | 3300042606 | Bacteria | 10232 |
| 46 | Ga0466719_490931 | 3300042606 | Unclassified | 14760 |
| 47 | Ga0466721_031304 | 3300042608 | Bacteria | 28285 |
| 48 | Ga0123356_10028052 | 3300010049 | Bacteria | 5274 |
| 49 | Ga0123356_10283071 | 3300010049 | Bacteria | 1754 |
| 50 | Ga0123356_10488424 | 3300010049 | Bacteria | 1385 |
| 51 | Ga0123353_10135224 | 3300010167 | Bacteria | 3954 |
| 52 | Ga0123353_10247053 | 3300010167 | Bacteria | 2767 |
| 53 | Ga0123353_10274393 | 3300010167 | Bacteria | 2595 |
| 54 | Ga0123353_10328057 | 3300010167 | Bacteria | 2319 |
| 55 | Ga0123353_10499341 | 3300010167 | Bacteria | 1773 |
| 56 | IMNBL1DRAFT_c0000059 | 3300000062 | Bacteria | 103534 |
| 57 | Ga0466734_076413 | 3300042623 | Bacteria | 2033 |
| 58 | Ga0466702_057492 | 3300042635 | Bacteria | 1108 |
| 59 | Ga0466703_079815 | 3300042636 | Bacteria | 3744 |
| 60 | Ga0466703_321394 | 3300042636 | Unclassified | 2643 |
| 61 | Ga0466708_019552 | 3300042652 | Bacteria | 13196 |
| 62 | Ga0466708_077780 | 3300042652 | Bacteria | 2713 |
| 63 | Ga0466711_119563 | 3300042615 | Bacteria | 7787 |
| 64 | Ga0466711_386791 | 3300042615 | Bacteria | 1038 |
| 65 | Ga0466718_051056 | 3300042617 | Bacteria | 1204 |
| 66 | Ga0466726_138289 | 3300042619 | Bacteria | 10854 |
| 67 | Ga0466726_214539 | 3300042619 | Bacteria | 14954 |
| 68 | Ga0466696_334581 | 3300042596 | Bacteria | 3928 |
| 69 | Ga0466696_455165 | 3300042596 | Bacteria | 1381 |
| 70 | Ga0466706_045156 | 3300042599 | Bacteria | 6314 |
| 71 | Ga0466700_448886 | 3300042600 | Bacteria | 2025 |
| 72 | Ga0466713_130741 | 3300042602 | Unclassified | 1574 |
| 73 | Ga0123356_10009805 | 3300010049 | Bacteria | 9439 |
| 74 | Ga0123356_10031287 | 3300010049 | Bacteria | 4980 |
| 75 | Ga0123353_10074167 | 3300010167 | Bacteria | 5469 |
| 76 | Ga0123353_10442256 | 3300010167 | Bacteria | 1917 |
| 77 | Ga0123353_10750771 | 3300010167 | Bacteria | 1358 |
| 78 | Ga0123354_10013988 | 3300010882 | Bacteria | 12483 |
| 79 | 2227474620 | 2225789004 | Bacteria | 22974 |
| 80 | IMNBL1DRAFT_c0013825 | 3300000062 | Bacteria | 3595 |
| 81 | JGI24702J35022_10149996 | 3300002462 | Bacteria | 1307 |
| 82 | Ga0466705_024495 | 3300042612 | Bacteria | 1146 |
| 83 | Ga0466705_030857 | 3300042612 | Bacteria | 2987 |
| 84 | Ga0466705_218598 | 3300042612 | Bacteria | 22295 |
| 85 | Ga0466702_095246 | 3300042635 | Bacteria | 2585 |
| 86 | Ga0466702_217122 | 3300042635 | Bacteria | 2358 |
| 87 | Ga0466703_098698 | 3300042636 | Bacteria | 8709 |
| 88 | Ga0466703_425555 | 3300042636 | Bacteria | 2818 |
| 89 | Ga0466704_396870 | 3300042643 | Unclassified | 3138 |
| 90 | Ga0466704_419806 | 3300042643 | Unclassified | 13258 |
| 91 | Ga0466725_041366 | 3300042654 | Bacteria | 51248 |
| 92 | Ga0466727_134366 | 3300042655 | Bacteria | 2103 |
| 93 | Ga0466711_157463 | 3300042615 | Bacteria | 1956 |
| 94 | Ga0466711_265183 | 3300042615 | Bacteria | 8806 |
| 95 | Ga0466715_195475 | 3300042616 | Bacteria | 21250 |
| 96 | Ga0466723_035382 | 3300042618 | Bacteria | 14861 |
| 97 | Ga0466726_237757 | 3300042619 | Bacteria | 1872 |
| 98 | Ga0466690_036695 | 3300042590 | Bacteria | 7519 |
| 99 | Ga0466690_056735 | 3300042590 | Bacteria | 2768 |
| 100 | Ga0466692_054467 | 3300042591 | Unclassified | 17222 |
| 101 | Ga0466706_138962 | 3300042599 | Bacteria | 14029 |
| 102 | Ga0466707_024641 | 3300042601 | Bacteria | 2962 |
| 103 | Ga0466707_106581 | 3300042601 | Bacteria | 3429 |
| 104 | Ga0466707_334795 | 3300042601 | Bacteria | 6579 |
| 105 | Ga0466719_088276 | 3300042606 | Bacteria | 4148 |
| 106 | Ga0466719_378039 | 3300042606 | Bacteria | 6851 |
| 107 | Ga0123355_10000682 | 3300009826 | Bacteria | 46160 |
| 108 | Ga0123353_10088628 | 3300010167 | Bacteria | 4983 |
| 109 | Ga0123353_10286069 | 3300010167 | Bacteria | 2528 |
| 110 | Ga0123353_10644417 | 3300010167 | Bacteria | 1501 |
| 111 | Ga0123353_10676003 | 3300010167 | Bacteria | 1455 |
| 112 | Ga0123353_11206548 | 3300010167 | Bacteria | 992 |
| 113 | JGI24695J34938_10014630 | 3300002450 | Bacteria | 4059 |
| 114 | JGI24702J35022_10118588 | 3300002462 | Bacteria | 1460 |
| 115 | JGI24700J35501_10930789 | 3300002508 | Bacteria | 24096 |
| 116 | Ga0466735_130053 | 3300042624 | Bacteria | 5694 |
| 117 | Ga0466735_187664 | 3300042624 | Bacteria | 1557 |
| 118 | Ga0466704_065893 | 3300042643 | Bacteria | 5068 |
| 119 | Ga0466704_105985 | 3300042643 | Bacteria | 1960 |
| 120 | Ga0466704_491273 | 3300042643 | Unclassified | 1408 |
| 121 | Ga0466708_015912 | 3300042652 | Bacteria | 25869 |
| 122 | Ga0466708_223314 | 3300042652 | Bacteria | 1507 |
| 123 | Ga0466708_424656 | 3300042652 | Bacteria | 32014 |
| 124 | Ga0466733_021999 | 3300042659 | Bacteria | 14358 |
| 125 | Ga0466733_161608 | 3300042659 | Bacteria | 1467 |
| 126 | Ga0466715_206612 | 3300042616 | Bacteria | 3086 |
| 127 | Ga0466715_414580 | 3300042616 | Bacteria | 7605 |
| 128 | Ga0466715_504134 | 3300042616 | Bacteria | 2958 |
| 129 | Ga0466715_601679 | 3300042616 | Bacteria | 1398 |
| 130 | Ga0466723_187409 | 3300042618 | Bacteria | 6785 |
| 131 | Ga0466726_191355 | 3300042619 | Bacteria | 1756 |
| 132 | Ga0466726_368567 | 3300042619 | Bacteria | 3362 |
| 133 | Ga0466691_088395 | 3300042593 | Bacteria | 11245 |
| 134 | Ga0466691_111367 | 3300042593 | Bacteria | 8790 |
| 135 | Ga0466696_164237 | 3300042596 | Bacteria | 2361 |
| 136 | Ga0466696_415138 | 3300042596 | Bacteria | 3099 |
| 137 | Ga0466706_265778 | 3300042599 | Bacteria | 1805 |
| 138 | Ga0466713_124614 | 3300042602 | Bacteria | 8372 |
| 139 | Ga0466719_539526 | 3300042606 | Bacteria | 2439 |
| 140 | Ga0123357_10008134 | 3300009784 | Bacteria | 13069 |
| 141 | Ga0123355_10073153 | 3300009826 | Bacteria | 5494 |
| 142 | Ga0123353_10063198 | 3300010167 | Bacteria | 5938 |
| 143 | Ga0123353_10082305 | 3300010167 | Bacteria | 5177 |
| 144 | Ga0123353_10107001 | 3300010167 | Bacteria | 4506 |
| 145 | Ga0123353_10805552 | 3300010167 | Bacteria | 1296 |
| 146 | Ga0123353_11040555 | 3300010167 | Archaea | 1095 |
| 147 | Ga0123354_10262522 | 3300010882 | Bacteria | 1721 |
| 148 | IMNBL1DRAFT_c0006229 | 3300000062 | Bacteria | 6558 |
| 149 | JGI24702J35022_10013070 | 3300002462 | Bacteria | 4605 |
| 150 | Ga0466703_233185 | 3300042636 | Bacteria | 3954 |
| 151 | Ga0466703_355013 | 3300042636 | Bacteria | 6267 |
| 152 | Ga0466709_232857 | 3300042648 | Bacteria | 5566 |
| 153 | Ga0466708_393856 | 3300042652 | Bacteria | 96483 |
| 154 | Ga0466727_288953 | 3300042655 | Bacteria | 3351 |
| 155 | Ga0466733_065725 | 3300042659 | Bacteria | 2236 |
| 156 | Ga0466733_086240 | 3300042659 | Bacteria | 6416 |
| 157 | Ga0466711_222219 | 3300042615 | Bacteria | 7528 |
| 158 | Ga0466715_129530 | 3300042616 | Bacteria | 3079 |
| 159 | Ga0466723_150179 | 3300042618 | Bacteria | 1689 |
| 160 | Ga0466723_157735 | 3300042618 | Bacteria | 1148 |
| 161 | Ga0466726_049865 | 3300042619 | Bacteria | 15308 |
| 162 | Ga0466692_001420 | 3300042591 | Bacteria | 3249 |
| 163 | Ga0466696_260405 | 3300042596 | Bacteria | 2195 |
| 164 | Ga0466696_369565 | 3300042596 | Viruses | 11370 |
| 165 | Ga0466707_015472 | 3300042601 | Bacteria | 11343 |
| 166 | Ga0466707_115549 | 3300042601 | Bacteria | 10494 |
| 167 | Ga0466713_094370 | 3300042602 | Bacteria | 3092 |
| 168 | Ga0466713_112702 | 3300042602 | Bacteria | 13204 |
| 169 | Ga0466713_134960 | 3300042602 | Bacteria | 119382 |
| 170 | Ga0466716_104833 | 3300042605 | Bacteria | 8638 |
| 171 | Ga0466719_106081 | 3300042606 | Bacteria | 4412 |
| 172 | Ga0466719_164970 | 3300042606 | Bacteria | 3735 |
| 173 | Ga0123356_10018243 | 3300010049 | Bacteria | 6665 |
| 174 | Ga0123356_10312680 | 3300010049 | Bacteria | 1681 |
| 175 | Ga0123353_10007769 | 3300010167 | Bacteria | 14551 |
| 176 | Ga0123353_10198625 | 3300010167 | Bacteria | 3158 |
| 177 | Ga0123353_10237576 | 3300010167 | Bacteria | 2835 |
| 178 | Ga0123353_10995417 | 3300010167 | Bacteria | 1127 |
| 179 | 2227276934 | 2225789004 | Bacteria | 1267 |
| 180 | Ga0466705_034932 | 3300042612 | Bacteria | 17547 |
| 181 | Ga0466705_094412 | 3300042612 | Bacteria | 2801 |
| 182 | Ga0466705_307956 | 3300042612 | Bacteria | 1782 |
| 183 | Ga0466704_181065 | 3300042643 | Bacteria | 15147 |
| 184 | Ga0466704_196279 | 3300042643 | Bacteria | 8342 |
| 185 | Ga0466709_204823 | 3300042648 | Bacteria | 202980 |
| 186 | Ga0466724_08822 | 3300042649 | Bacteria | 22902 |
| 187 | Ga0466724_27242 | 3300042649 | Bacteria | 3901 |
| 188 | Ga0466708_052544 | 3300042652 | Bacteria | 44464 |
| 189 | Ga0466708_262285 | 3300042652 | Bacteria | 3627 |
| 190 | Ga0466727_056742 | 3300042655 | Bacteria | 20340 |
| 191 | Ga0466727_071539 | 3300042655 | Unclassified | 2481 |
| 192 | Ga0466733_209374 | 3300042659 | Bacteria | 4089 |
| 193 | Ga0466705_436703 | 3300042612 | Bacteria | 1844 |
| 194 | Ga0466705_449633 | 3300042612 | Bacteria | 11617 |
| 195 | Ga0466711_005794 | 3300042615 | Bacteria | 4398 |
| 196 | Ga0466715_278367 | 3300042616 | Bacteria | 19026 |
| 197 | Ga0466728_059263 | 3300042620 | Bacteria | 8310 |
| 198 | Ga0466728_151726 | 3300042620 | Bacteria | 9022 |
| 199 | Ga0466728_433251 | 3300042620 | Bacteria | 4054 |
| 200 | Ga0466729_104390 | 3300042621 | Bacteria | 6220 |
| 201 | Ga0466656_056636 | 3300042550 | Bacteria | 5939 |
| 202 | Ga0466692_100079 | 3300042591 | Bacteria | 1159 |
| 203 | Ga0466696_212452 | 3300042596 | Unclassified | 1118 |
| 204 | Ga0466696_321720 | 3300042596 | Bacteria | 7807 |
| 205 | Ga0466696_382747 | 3300042596 | Bacteria | 1100 |
| 206 | Ga0466707_141538 | 3300042601 | Bacteria | 19775 |
| 207 | Ga0466707_165032 | 3300042601 | Bacteria | 1052 |
| 208 | Ga0466707_216745 | 3300042601 | Bacteria | 5093 |
| 209 | Ga0466707_277263 | 3300042601 | Bacteria | 4591 |
| 210 | Ga0466713_119321 | 3300042602 | Bacteria | 2026 |
| 211 | Ga0466717_308709 | 3300042604 | Bacteria | 1824 |
| 212 | Ga0466719_069979 | 3300042606 | Bacteria | 15553 |
| 213 | Ga0466719_400268 | 3300042606 | Bacteria | 2914 |
| 214 | Ga0123357_10011041 | 3300009784 | Bacteria | 11551 |
| 215 | Ga0123355_10078736 | 3300009826 | Bacteria | 5266 |
| 216 | Ga0123356_10005290 | 3300010049 | Bacteria | 13161 |
| 217 | Ga0123356_10044062 | 3300010049 | Bacteria | 4153 |
| 218 | Ga0123356_10175243 | 3300010049 | Bacteria | 2160 |
| 219 | Ga0123353_10000089 | 3300010167 | Bacteria | 102894 |
| 220 | Ga0123353_10091512 | 3300010167 | Bacteria | 4899 |
| 221 | Ga0123353_10110919 | 3300010167 | Bacteria | 4419 |
| 222 | Ga0123353_10186086 | 3300010167 | Bacteria | 3284 |
| 223 | Ga0123353_10222495 | 3300010167 | Bacteria | 2950 |
| 224 | Ga0123353_10318728 | 3300010167 | Bacteria | 2361 |
| 225 | Ga0123354_10173882 | 3300010882 | Bacteria | 2492 |
| 226 | 2227068290 | 2225789003 | Unclassified | 3000 |
| 227 | JGI24699J35502_11081538 | 3300002509 | Bacteria | 1982 |
| 228 | Ga0068305_11082097 | 3300005083 | Bacteria | 1080 |
| 229 | Ga0466705_078274 | 3300042612 | Bacteria | 7397 |
| 230 | Ga0466705_257873 | 3300042612 | Bacteria | 1422 |
| 231 | Ga0466704_282944 | 3300042643 | Bacteria | 16312 |
| 232 | Ga0466704_556223 | 3300042643 | Bacteria | 1617 |
| 233 | Ga0466727_061133 | 3300042655 | Bacteria | 4076 |
| 234 | Ga0466727_286642 | 3300042655 | Bacteria | 2207 |
| 235 | Ga0466715_464102 | 3300042616 | Bacteria | 1940 |
| 236 | Ga0466723_219930 | 3300042618 | Bacteria | 1310 |
| 237 | Ga0466728_136971 | 3300042620 | Bacteria | 3443 |
| 238 | Ga0466691_089686 | 3300042593 | Bacteria | 3462 |
| 239 | Ga0466694_142347 | 3300042594 | Bacteria | 1164 |
| 240 | Ga0466696_033065 | 3300042596 | Bacteria | 11392 |
| 241 | Ga0466696_411546 | 3300042596 | Unclassified | 2438 |
| 242 | Ga0466700_310757 | 3300042600 | Archaea | 1868 |
| 243 | Ga0466700_373563 | 3300042600 | Bacteria | 2806 |
| 244 | Ga0466707_128894 | 3300042601 | Bacteria | 23623 |
| 245 | Ga0466707_233190 | 3300042601 | Bacteria | 13615 |
| 246 | Ga0466713_057432 | 3300042602 | Bacteria | 2320 |
| 247 | Ga0466719_102513 | 3300042606 | Bacteria | 4417 |
| 248 | Ga0123355_10004270 | 3300009826 | Bacteria | 20761 |
| 249 | Ga0123356_10039983 | 3300010049 | Bacteria | 4370 |
| 250 | Ga0123353_10133375 | 3300010167 | Bacteria | 3984 |
| 251 | Ga0123353_10243121 | 3300010167 | Bacteria | 2795 |
| 252 | Ga0123354_10436878 | 3300010882 | Bacteria | 1072 |
| 253 | 2227532962 | 2225789004 | Bacteria | 16174 |
| 254 | IMNBL1DRAFT_c0054564 | 3300000062 | Bacteria | 1237 |
| 255 | JGI24702J35022_10000201 | 3300002462 | Bacteria | 32549 |
| 256 | Ga0466705_057332 | 3300042612 | Bacteria | 1176 |
| 257 | Ga0466705_105996 | 3300042612 | Bacteria | 18576 |
| 258 | Ga0466705_274862 | 3300042612 | Bacteria | 3323 |
| 259 | Ga0466703_098416 | 3300042636 | Bacteria | 4126 |
| 260 | Ga0466703_107756 | 3300042636 | Bacteria | 8226 |
| 261 | Ga0466704_287616 | 3300042643 | Bacteria | 4459 |
| 262 | Ga0466704_324200 | 3300042643 | Bacteria | 1192 |
| 263 | Ga0466708_184314 | 3300042652 | Bacteria | 8045 |
| 264 | Ga0466725_141586 | 3300042654 | Bacteria | 1060 |
| 265 | Ga0466727_066359 | 3300042655 | Bacteria | 14996 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03446 | GO:0050661 | NADP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.