Protein Family IF09431
Metagenome
Isolate
252
Members
49
Samples
246
Scaffolds
271.81
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_231396|Ga0466704_231396_482_1468
- Length
- 328 aa
- Sequence
- MRPNEVLKKSPRSVCSLQVEVLYLACDGSIPPRKFETGSIANQNLPSHTVLCYTLVVNSRIASFRKTVIDYYCMSGRKTLPWRINTAPWPVLVSEFMLQQTQIERVIPYWERWMRMWPQPADLANAPLADALREWSGLGYNRRGRFLWECSRHITDVFGGVVPDTPKKLVTLPGVGAYTAGAVACFAYNYPAVFVETNIRAALIHFFFADRERDHDADLAGILEESLCGEDNPRIWYWALMDYGAALKKAAPNPNRRSAHYTRQSRFEGSFRQRRGAILRSLVTEGAASAECLADRTGIAPEQLYDALAALEKDFMVVSDSGMYSAGR
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.4%
Kalotermitidae
29.8%
Unclassified
14.9%
Termopsidae
6.4%
Rhinotermitidae
6.4%
Hodotermitidae
2.1%
Taxonomy
Archaea
1
Bacteria
245
Eukaryota
0
Viruses
1
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 2 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 3 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 4 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 43 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 44 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 47 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10148536 | 3300010882 | Bacteria | 2854 |
| 2 | Ga0466712_050542 | 3300042614 | Bacteria | 6243 |
| 3 | Ga0466718_022853 | 3300042617 | Bacteria | 49734 |
| 4 | Ga0466718_036625 | 3300042617 | Bacteria | 10743 |
| 5 | Ga0466718_066061 | 3300042617 | Bacteria | 5171 |
| 6 | Ga0466716_357173 | 3300042605 | Bacteria | 1705 |
| 7 | Ga0466719_549467 | 3300042606 | Bacteria | 1989 |
| 8 | Ga0466720_011344 | 3300042607 | Bacteria | 20957 |
| 9 | Ga0466720_120931 | 3300042607 | Bacteria | 1503 |
| 10 | JGI24698J34947_10048151 | 3300002449 | Bacteria | 2160 |
| 11 | JGI24698J34947_10117211 | 3300002449 | Bacteria | 1163 |
| 12 | Ga0072940_1112423 | 3300005200 | Bacteria | 1899 |
| 13 | Ga0072941_1001116 | 3300005201 | Bacteria | 50216 |
| 14 | Ga0072941_1003147 | 3300005201 | Bacteria | 83880 |
| 15 | Ga0466735_098603 | 3300042624 | Bacteria | 13417 |
| 16 | Ga0466703_043532 | 3300042636 | Bacteria | 16956 |
| 17 | Ga0466704_220379 | 3300042643 | Bacteria | 12660 |
| 18 | Ga0466704_280512 | 3300042643 | Bacteria | 8861 |
| 19 | Ga0466709_024787 | 3300042648 | Bacteria | 26369 |
| 20 | Ga0466709_258825 | 3300042648 | Bacteria | 56335 |
| 21 | Ga0466708_041688 | 3300042652 | Bacteria | 40918 |
| 22 | Ga0466727_265961 | 3300042655 | Bacteria | 1444 |
| 23 | Ga0466690_003369 | 3300042590 | Bacteria | 1100 |
| 24 | Ga0466690_065950 | 3300042590 | Bacteria | 1889 |
| 25 | Ga0466690_096133 | 3300042590 | Bacteria | 10685 |
| 26 | Ga0466690_140228 | 3300042590 | Bacteria | 3322 |
| 27 | Ga0466690_273349 | 3300042590 | Bacteria | 14692 |
| 28 | Ga0466691_097878 | 3300042593 | Bacteria | 3794 |
| 29 | Ga0466691_219991 | 3300042593 | Bacteria | 33482 |
| 30 | Ga0466696_010817 | 3300042596 | Bacteria | 8867 |
| 31 | Ga0466715_245983 | 3300042616 | Bacteria | 27497 |
| 32 | Ga0466715_392072 | 3300042616 | Bacteria | 7959 |
| 33 | Ga0466718_000302 | 3300042617 | Bacteria | 9991 |
| 34 | Ga0466718_069391 | 3300042617 | Bacteria | 2081 |
| 35 | Ga0466726_079922 | 3300042619 | Bacteria | 2781 |
| 36 | Ga0466728_336987 | 3300042620 | Bacteria | 1588 |
| 37 | Ga0466716_119765 | 3300042605 | Bacteria | 7157 |
| 38 | Ga0466719_054251 | 3300042606 | Bacteria | 2210 |
| 39 | Ga0466719_427658 | 3300042606 | Bacteria | 6770 |
| 40 | Ga0466720_117802 | 3300042607 | Bacteria | 5335 |
| 41 | Ga0466722_159137 | 3300042609 | Bacteria | 1100 |
| 42 | Ga0466698_514428 | 3300042610 | Bacteria | 11096 |
| 43 | Ga0072941_1044161 | 3300005201 | Bacteria | 4440 |
| 44 | Ga0072941_1092637 | 3300005201 | Bacteria | 1044 |
| 45 | Ga0466705_023063 | 3300042612 | Bacteria | 6477 |
| 46 | Ga0466703_230228 | 3300042636 | Unclassified | 3617 |
| 47 | Ga0466704_209964 | 3300042643 | Bacteria | 21692 |
| 48 | Ga0466704_560874 | 3300042643 | Bacteria | 79195 |
| 49 | Ga0466727_084571 | 3300042655 | Bacteria | 1116 |
| 50 | Ga0456237_0004017 | 3300041968 | Bacteria | 2367 |
| 51 | Ga0466690_260370 | 3300042590 | Bacteria | 2578 |
| 52 | Ga0466694_122829 | 3300042594 | Bacteria | 3568 |
| 53 | Ga0466696_257067 | 3300042596 | Bacteria | 31188 |
| 54 | Ga0466699_196859 | 3300042597 | Bacteria | 2536 |
| 55 | Ga0466699_358612 | 3300042597 | Bacteria | 17888 |
| 56 | Ga0466732_178974 | 3300042656 | Bacteria | 7927 |
| 57 | Ga0466705_414919 | 3300042612 | Bacteria | 2625 |
| 58 | Ga0466712_025807 | 3300042614 | Bacteria | 1051 |
| 59 | Ga0466712_026242 | 3300042614 | Bacteria | 2092 |
| 60 | Ga0466712_067298 | 3300042614 | Bacteria | 6159 |
| 61 | Ga0466712_295982 | 3300042614 | Bacteria | 2721 |
| 62 | Ga0466715_069646 | 3300042616 | Bacteria | 4579 |
| 63 | Ga0466715_264687 | 3300042616 | Bacteria | 1427 |
| 64 | Ga0466718_136317 | 3300042617 | Bacteria | 1290 |
| 65 | Ga0466723_247415 | 3300042618 | Bacteria | 31896 |
| 66 | Ga0466726_003203 | 3300042619 | Bacteria | 2621 |
| 67 | Ga0466726_132396 | 3300042619 | Bacteria | 1098 |
| 68 | Ga0466726_244911 | 3300042619 | Bacteria | 2462 |
| 69 | Ga0466720_043556 | 3300042607 | Bacteria | 3239 |
| 70 | Ga0466720_070246 | 3300042607 | Bacteria | 32368 |
| 71 | Ga0466722_247086 | 3300042609 | Bacteria | 22350 |
| 72 | AustNasuHG_c1000566 | 3300000089 | Bacteria | 13048 |
| 73 | JGI24698J34947_10026634 | 3300002449 | Bacteria | 3071 |
| 74 | Ga0072940_1072705 | 3300005200 | Bacteria | 1149 |
| 75 | Ga0072940_1267785 | 3300005200 | Bacteria | 1248 |
| 76 | Ga0072941_1007225 | 3300005201 | Bacteria | 19763 |
| 77 | Ga0074263_103485 | 3300005485 | Bacteria | 3310 |
| 78 | Ga0466705_224184 | 3300042612 | Bacteria | 17581 |
| 79 | Ga0466703_068866 | 3300042636 | Bacteria | 9737 |
| 80 | Ga0466703_168702 | 3300042636 | Bacteria | 28068 |
| 81 | Ga0466703_236400 | 3300042636 | Bacteria | 7370 |
| 82 | Ga0466704_224110 | 3300042643 | Bacteria | 3623 |
| 83 | Ga0466704_590378 | 3300042643 | Bacteria | 3175 |
| 84 | Ga0466709_101216 | 3300042648 | Bacteria | 1813 |
| 85 | Ga0466709_187453 | 3300042648 | Bacteria | 7099 |
| 86 | Ga0466708_422837 | 3300042652 | Bacteria | 3485 |
| 87 | Ga0264413_104713 | 3300024493 | Bacteria | 35389 |
| 88 | Ga0466696_109997 | 3300042596 | Bacteria | 1633 |
| 89 | Ga0466699_138015 | 3300042597 | Bacteria | 4548 |
| 90 | Ga0466711_292683 | 3300042615 | Bacteria | 3479 |
| 91 | Ga0466711_318904 | 3300042615 | Bacteria | 2728 |
| 92 | Ga0466715_010506 | 3300042616 | Bacteria | 6950 |
| 93 | Ga0466715_015628 | 3300042616 | Bacteria | 24825 |
| 94 | Ga0466723_302900 | 3300042618 | Bacteria | 2635 |
| 95 | Ga0466726_461181 | 3300042619 | Bacteria | 1119 |
| 96 | Ga0466707_136813 | 3300042601 | Bacteria | 2296 |
| 97 | Ga0466719_170031 | 3300042606 | Bacteria | 1447 |
| 98 | Ga0466720_036827 | 3300042607 | Bacteria | 40262 |
| 99 | Ga0466722_154593 | 3300042609 | Bacteria | 4641 |
| 100 | Ga0466722_229128 | 3300042609 | Bacteria | 4422 |
| 101 | JGI24698J34947_10002139 | 3300002449 | Bacteria | 10581 |
| 102 | JGI24698J34947_10003136 | 3300002449 | Bacteria | 8952 |
| 103 | JGI24698J34947_10082832 | 3300002449 | Unclassified | 1498 |
| 104 | Ga0072940_1019620 | 3300005200 | Bacteria | 4604 |
| 105 | Ga0072940_1263325 | 3300005200 | Bacteria | 1271 |
| 106 | Ga0072941_1001626 | 3300005201 | Bacteria | 73081 |
| 107 | Ga0072941_1013975 | 3300005201 | Bacteria | 17788 |
| 108 | Ga0072941_1044467 | 3300005201 | Bacteria | 12681 |
| 109 | Ga0466735_005189 | 3300042624 | Bacteria | 3093 |
| 110 | Ga0466703_032348 | 3300042636 | Bacteria | 64713 |
| 111 | Ga0466703_116621 | 3300042636 | Bacteria | 6361 |
| 112 | Ga0466709_103670 | 3300042648 | Bacteria | 3032 |
| 113 | Ga0466727_006242 | 3300042655 | Bacteria | 2122 |
| 114 | Ga0415639_118267 | 3300038395 | Bacteria | 4140 |
| 115 | Ga0466690_027628 | 3300042590 | Bacteria | 11562 |
| 116 | Ga0466690_158066 | 3300042590 | Bacteria | 4340 |
| 117 | Ga0466692_111092 | 3300042591 | Bacteria | 21683 |
| 118 | Ga0466691_013817 | 3300042593 | Bacteria | 4467 |
| 119 | Ga0466694_040333 | 3300042594 | Bacteria | 17463 |
| 120 | Ga0466694_407945 | 3300042594 | Bacteria | 1112 |
| 121 | Ga0466696_196762 | 3300042596 | Bacteria | 15722 |
| 122 | Ga0466699_087516 | 3300042597 | Bacteria | 3389 |
| 123 | Ga0466732_367648 | 3300042656 | Bacteria | 5480 |
| 124 | Ga0466705_402038 | 3300042612 | Bacteria | 3691 |
| 125 | Ga0466712_263031 | 3300042614 | Bacteria | 2586 |
| 126 | Ga0466711_421492 | 3300042615 | Bacteria | 4523 |
| 127 | Ga0466715_146210 | 3300042616 | Bacteria | 1979 |
| 128 | Ga0466715_382797 | 3300042616 | Bacteria | 20304 |
| 129 | Ga0466723_058722 | 3300042618 | Bacteria | 2410 |
| 130 | Ga0466723_061419 | 3300042618 | Bacteria | 2045 |
| 131 | Ga0466723_122519 | 3300042618 | Bacteria | 7632 |
| 132 | Ga0466726_004068 | 3300042619 | Bacteria | 5488 |
| 133 | Ga0466726_223318 | 3300042619 | Bacteria | 4444 |
| 134 | Ga0466726_227268 | 3300042619 | Bacteria | 7354 |
| 135 | Ga0466726_495465 | 3300042619 | Bacteria | 1014 |
| 136 | Ga0466728_394027 | 3300042620 | Bacteria | 3063 |
| 137 | Ga0466706_190390 | 3300042599 | Bacteria | 1946 |
| 138 | Ga0466707_023181 | 3300042601 | Bacteria | 1948 |
| 139 | Ga0466716_057801 | 3300042605 | Bacteria | 5698 |
| 140 | Ga0466720_062556 | 3300042607 | Bacteria | 4424 |
| 141 | Ga0466720_118561 | 3300042607 | Bacteria | 1596 |
| 142 | Ga0466720_211375 | 3300042607 | Bacteria | 60841 |
| 143 | Ga0466722_075640 | 3300042609 | Bacteria | 9338 |
| 144 | JGI24698J34947_10000364 | 3300002449 | Bacteria | 20304 |
| 145 | JGI24698J34947_10002405 | 3300002449 | Unclassified | 10074 |
| 146 | JGI24698J34947_10092744 | 3300002449 | Bacteria | 1380 |
| 147 | JGI24699J35502_11133967 | 3300002509 | Bacteria | 21911 |
| 148 | Ga0466703_082590 | 3300042636 | Bacteria | 51436 |
| 149 | Ga0466703_169286 | 3300042636 | Bacteria | 2742 |
| 150 | Ga0466709_101320 | 3300042648 | Bacteria | 5777 |
| 151 | Ga0466727_348197 | 3300042655 | Bacteria | 1108 |
| 152 | Ga0466732_070277 | 3300042656 | Unclassified | 2871 |
| 153 | Ga0123353_10512021 | 3300010167 | Bacteria | 1744 |
| 154 | Ga0466712_087536 | 3300042614 | Bacteria | 8047 |
| 155 | Ga0466723_254889 | 3300042618 | Bacteria | 9060 |
| 156 | Ga0466723_333336 | 3300042618 | Bacteria | 1599 |
| 157 | Ga0466726_307637 | 3300042619 | Bacteria | 3104 |
| 158 | Ga0466726_432998 | 3300042619 | Bacteria | 1274 |
| 159 | Ga0466728_218897 | 3300042620 | Bacteria | 14058 |
| 160 | Ga0466706_289124 | 3300042599 | Bacteria | 15701 |
| 161 | Ga0466716_106217 | 3300042605 | Bacteria | 1871 |
| 162 | Ga0466716_286824 | 3300042605 | Bacteria | 20779 |
| 163 | Ga0466719_085625 | 3300042606 | Bacteria | 4078 |
| 164 | Ga0466719_149587 | 3300042606 | Bacteria | 3320 |
| 165 | Ga0466720_010554 | 3300042607 | Bacteria | 31855 |
| 166 | Ga0466720_101461 | 3300042607 | Bacteria | 9414 |
| 167 | Ga0072940_1045549 | 3300005200 | Bacteria | 5514 |
| 168 | Ga0072941_1068565 | 3300005201 | Bacteria | 7919 |
| 169 | Ga0466735_104260 | 3300042624 | Unclassified | 1151 |
| 170 | Ga0466730_071818 | 3300042625 | Bacteria | 1368 |
| 171 | Ga0466703_380334 | 3300042636 | Bacteria | 4729 |
| 172 | Ga0466704_074085 | 3300042643 | Bacteria | 3880 |
| 173 | Ga0466709_130954 | 3300042648 | Bacteria | 6856 |
| 174 | Ga0466708_196105 | 3300042652 | Bacteria | 4367 |
| 175 | Ga0466708_343694 | 3300042652 | Bacteria | 5591 |
| 176 | Ga0466692_031129 | 3300042591 | Archaea | 21859 |
| 177 | Ga0466692_036694 | 3300042591 | Bacteria | 15700 |
| 178 | Ga0466692_079610 | 3300042591 | Bacteria | 13253 |
| 179 | Ga0466691_121161 | 3300042593 | Bacteria | 15632 |
| 180 | Ga0466691_135897 | 3300042593 | Bacteria | 2280 |
| 181 | Ga0466695_237040 | 3300042595 | Bacteria | 1419 |
| 182 | Ga0466699_174915 | 3300042597 | Bacteria | 2153 |
| 183 | Ga0466733_039242 | 3300042659 | Bacteria | 4010 |
| 184 | Ga0123355_10444338 | 3300009826 | Bacteria | 1639 |
| 185 | Ga0466705_410542 | 3300042612 | Bacteria | 3038 |
| 186 | Ga0466712_076271 | 3300042614 | Bacteria | 7196 |
| 187 | Ga0466711_462209 | 3300042615 | Bacteria | 1479 |
| 188 | Ga0466715_029813 | 3300042616 | Bacteria | 45096 |
| 189 | Ga0466715_134909 | 3300042616 | Bacteria | 3803 |
| 190 | Ga0466718_060388 | 3300042617 | Bacteria | 28683 |
| 191 | Ga0466723_263294 | 3300042618 | Viruses | 6538 |
| 192 | Ga0466707_177778 | 3300042601 | Bacteria | 1397 |
| 193 | Ga0466719_216786 | 3300042606 | Bacteria | 5193 |
| 194 | Ga0466719_482163 | 3300042606 | Bacteria | 1128 |
| 195 | Ga0466722_096448 | 3300042609 | Bacteria | 3555 |
| 196 | Ga0466722_123343 | 3300042609 | Bacteria | 31379 |
| 197 | Ga0072941_1020688 | 3300005201 | Bacteria | 3245 |
| 198 | Ga0074263_112565 | 3300005485 | Bacteria | 2086 |
| 199 | Ga0466705_096937 | 3300042612 | Bacteria | 11658 |
| 200 | Ga0466703_167582 | 3300042636 | Bacteria | 2972 |
| 201 | Ga0466703_327345 | 3300042636 | Bacteria | 24262 |
| 202 | Ga0466704_028477 | 3300042643 | Bacteria | 15476 |
| 203 | Ga0466704_122879 | 3300042643 | Bacteria | 10014 |
| 204 | Ga0466708_086897 | 3300042652 | Bacteria | 18459 |
| 205 | Ga0466708_113300 | 3300042652 | Bacteria | 53667 |
| 206 | Ga0264413_116292 | 3300024493 | Bacteria | 15643 |
| 207 | Ga0466691_151543 | 3300042593 | Bacteria | 3374 |
| 208 | Ga0466694_287461 | 3300042594 | Bacteria | 4578 |
| 209 | Ga0466696_094268 | 3300042596 | Bacteria | 6686 |
| 210 | Ga0466699_155968 | 3300042597 | Bacteria | 6019 |
| 211 | Ga0466711_461138 | 3300042615 | Bacteria | 1145 |
| 212 | Ga0466715_172948 | 3300042616 | Bacteria | 3799 |
| 213 | Ga0466723_026390 | 3300042618 | Bacteria | 14641 |
| 214 | Ga0466723_028615 | 3300042618 | Bacteria | 3892 |
| 215 | Ga0466726_086021 | 3300042619 | Bacteria | 1329 |
| 216 | Ga0466726_124671 | 3300042619 | Bacteria | 2722 |
| 217 | Ga0466726_165106 | 3300042619 | Bacteria | 10906 |
| 218 | Ga0466726_378273 | 3300042619 | Bacteria | 2702 |
| 219 | Ga0466726_463263 | 3300042619 | Bacteria | 4597 |
| 220 | Ga0466728_033420 | 3300042620 | Bacteria | 9298 |
| 221 | Ga0466728_440117 | 3300042620 | Bacteria | 2909 |
| 222 | Ga0466716_306211 | 3300042605 | Bacteria | 5971 |
| 223 | Ga0466719_295652 | 3300042606 | Bacteria | 2597 |
| 224 | Ga0466720_003628 | 3300042607 | Bacteria | 2034 |
| 225 | Ga0466720_009249 | 3300042607 | Bacteria | 16487 |
| 226 | Ga0466720_031913 | 3300042607 | Bacteria | 26039 |
| 227 | Ga0466720_195368 | 3300042607 | Bacteria | 2598 |
| 228 | Ga0466722_016807 | 3300042609 | Bacteria | 2828 |
| 229 | JGI24698J34947_10013154 | 3300002449 | Bacteria | 4522 |
| 230 | Ga0072941_1001982 | 3300005201 | Bacteria | 47195 |
| 231 | Ga0466705_346061 | 3300042612 | Bacteria | 2049 |
| 232 | Ga0466735_005337 | 3300042624 | Bacteria | 11848 |
| 233 | Ga0466735_206218 | 3300042624 | Bacteria | 1479 |
| 234 | Ga0466703_184563 | 3300042636 | Bacteria | 11891 |
| 235 | Ga0466704_231396 | 3300042643 | Bacteria | 3071 |
| 236 | Ga0466704_299566 | 3300042643 | Bacteria | 6443 |
| 237 | Ga0466709_384927 | 3300042648 | Bacteria | 6369 |
| 238 | Ga0466727_301046 | 3300042655 | Bacteria | 1675 |
| 239 | Ga0264413_117574 | 3300024493 | Bacteria | 3779 |
| 240 | Ga0466690_290184 | 3300042590 | Bacteria | 1306 |
| 241 | Ga0466692_031934 | 3300042591 | Bacteria | 29085 |
| 242 | Ga0466691_028083 | 3300042593 | Bacteria | 1429 |
| 243 | Ga0466695_316409 | 3300042595 | Bacteria | 7382 |
| 244 | Ga0466696_190814 | 3300042596 | Bacteria | 4102 |
| 245 | Ga0466696_384267 | 3300042596 | Bacteria | 6265 |
| 246 | Ga0466699_422209 | 3300042597 | Bacteria | 15817 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00633 | GO:0003677 | DNA binding | MF |
| PF00730 | GO:0006284 | base-excision repair | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.