Protein Family IF09379
Metagenome
Isolate
157
Members
57
Samples
150
Scaffolds
110.76
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_133648|Ga0466704_133648_1487_1888
- Length
- 133 aa
- Sequence
- MEDSTMTELSKDKLIEAISSLSIIELSELVKALEEKFGVSALAPTVMAAASTTNVVAADVVEEKTEFNVILTSIGASKINVIKVVREITGLGLKEAKDLVDGAPNIVKDNISKSEAEEIKKKLIEVGASVELK
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.7%
Kalotermitidae
25.5%
Unclassified
12.7%
Apidae
7.3%
Rhinotermitidae
5.5%
Passalidae
5.5%
Termopsidae
5.5%
Armadillidiidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 2 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 10 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 16 | 2820141685 | Unclassified Proteobacteria Emb289P3bin118 | Isolate | Unclassified |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 19 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 20 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 30 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 31 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 37 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 45 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 48 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 49 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 50 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 51 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 52 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_109379 | 3300042602 | Bacteria | 40861 |
| 2 | Ga0466719_042228 | 3300042606 | Bacteria | 1134 |
| 3 | Ga0466719_103466 | 3300042606 | Unclassified | 5223 |
| 4 | Ga0466719_110883 | 3300042606 | Bacteria | 3405 |
| 5 | Ga0466721_186390 | 3300042608 | Bacteria | 7274 |
| 6 | Ga0466722_024827 | 3300042609 | Bacteria | 13981 |
| 7 | Ga0456237_0023978 | 3300041968 | Bacteria | 834 |
| 8 | Ga0466691_127193 | 3300042593 | Bacteria | 1941 |
| 9 | Ga0466696_100303 | 3300042596 | Bacteria | 2835 |
| 10 | Ga0466715_119678 | 3300042616 | Bacteria | 6351 |
| 11 | Ga0466715_422059 | 3300042616 | Unclassified | 2836 |
| 12 | Ga0466723_001143 | 3300042618 | Bacteria | 2368 |
| 13 | Ga0466723_208580 | 3300042618 | Bacteria | 2274 |
| 14 | Ga0123353_10495908 | 3300010167 | Bacteria | 1781 |
| 15 | Ga0123353_13358657 | 3300010167 | Bacteria | 509 |
| 16 | Ga0466704_522060 | 3300042643 | Unclassified | 1092 |
| 17 | Ga0466708_323940 | 3300042652 | Bacteria | 18001 |
| 18 | Ga0466701_101169 | 3300042598 | Bacteria | 66668 |
| 19 | Ga0466714_009901 | 3300042603 | Bacteria | 2670 |
| 20 | Ga0466719_486404 | 3300042606 | Unclassified | 1144 |
| 21 | Ga0160445_102461 | 3300012847 | Bacteria | 4258 |
| 22 | 2227480184 | 2225789004 | Bacteria | 78831 |
| 23 | IMNBGM34_c000336 | 3300000036 | Bacteria | 13553 |
| 24 | IMNBL1DRAFT_c0013585 | 3300000062 | Bacteria | 3642 |
| 25 | JGI24698J34947_10000093 | 3300002449 | Bacteria | 30040 |
| 26 | Ga0068305_10010491 | 3300005083 | Bacteria | 4121 |
| 27 | Ga0466726_181241 | 3300042619 | Bacteria | 1036 |
| 28 | Ga0466726_286056 | 3300042619 | Bacteria | 2142 |
| 29 | Ga0466728_454406 | 3300042620 | Bacteria | 14071 |
| 30 | Ga0123357_10045950 | 3300009784 | Bacteria | 5923 |
| 31 | Ga0123356_10222717 | 3300010049 | Bacteria | 1944 |
| 32 | Ga0123353_10164343 | 3300010167 | Bacteria | 3530 |
| 33 | Ga0123353_11115384 | 3300010167 | Unclassified | 1046 |
| 34 | Ga0466735_142045 | 3300042624 | Bacteria | 10879 |
| 35 | Ga0466703_179910 | 3300042636 | Unclassified | 14152 |
| 36 | Ga0466704_152759 | 3300042643 | Unclassified | 1698 |
| 37 | Ga0466727_088208 | 3300042655 | Bacteria | 1756 |
| 38 | Ga0466727_215359 | 3300042655 | Bacteria | 55489 |
| 39 | Ga0466705_133380 | 3300042612 | Unclassified | 1651 |
| 40 | Ga0466705_145690 | 3300042612 | Bacteria | 3469 |
| 41 | Ga0466706_178199 | 3300042599 | Bacteria | 1971 |
| 42 | Ga0466713_005670 | 3300042602 | Bacteria | 17868 |
| 43 | Ga0466714_166528 | 3300042603 | Unclassified | 1879 |
| 44 | Ga0466716_254877 | 3300042605 | Unclassified | 10681 |
| 45 | Ga0466722_180033 | 3300042609 | Bacteria | 17185 |
| 46 | Ga0466722_183214 | 3300042609 | Bacteria | 1202 |
| 47 | Ga0466657_350508 | 3300042582 | Bacteria | 2543 |
| 48 | JGI24702J35022_10000366 | 3300002462 | Bacteria | 26831 |
| 49 | Ga0466729_038902 | 3300042621 | Bacteria | 3855 |
| 50 | Ga0123353_10446121 | 3300010167 | Bacteria | 1907 |
| 51 | Ga0123353_11018714 | 3300010167 | Bacteria | 1110 |
| 52 | Ga0466704_084114 | 3300042643 | Unclassified | 2485 |
| 53 | Ga0466704_133648 | 3300042643 | Bacteria | 13774 |
| 54 | Ga0466704_438042 | 3300042643 | Bacteria | 2104 |
| 55 | Ga0466709_141443 | 3300042648 | Unclassified | 14099 |
| 56 | Ga0466709_409593 | 3300042648 | Bacteria | 3368 |
| 57 | Ga0466727_198286 | 3300042655 | Bacteria | 11166 |
| 58 | Ga0466716_100238 | 3300042605 | Bacteria | 2154 |
| 59 | Ga0466719_138180 | 3300042606 | Bacteria | 3204 |
| 60 | Ga0466694_328893 | 3300042594 | Unclassified | 1623 |
| 61 | JGI24705J35276_12235773 | 3300002504 | Bacteria | 6966 |
| 62 | JGI24705J35276_12238355 | 3300002504 | Unclassified | 19870 |
| 63 | Ga0068305_10001856 | 3300005083 | Bacteria | 7094 |
| 64 | Ga0466715_118917 | 3300042616 | Bacteria | 13975 |
| 65 | Ga0466726_075076 | 3300042619 | Bacteria | 15349 |
| 66 | Ga0466728_330508 | 3300042620 | Bacteria | 20092 |
| 67 | Ga0466729_002566 | 3300042621 | Unclassified | 2914 |
| 68 | Ga0123356_10021554 | 3300010049 | Unclassified | 6081 |
| 69 | Ga0123354_10356467 | 3300010882 | Unclassified | 1296 |
| 70 | Ga0466735_008246 | 3300042624 | Bacteria | 2418 |
| 71 | Ga0466709_209507 | 3300042648 | Bacteria | 6668 |
| 72 | Ga0466708_045890 | 3300042652 | Bacteria | 13303 |
| 73 | Ga0466708_183984 | 3300042652 | Bacteria | 148491 |
| 74 | Ga0466705_084105 | 3300042612 | Bacteria | 1813 |
| 75 | Ga0466706_065083 | 3300042599 | Bacteria | 14584 |
| 76 | Ga0466716_356472 | 3300042605 | Unclassified | 6812 |
| 77 | Ga0466698_101504 | 3300042610 | Bacteria | 11573 |
| 78 | Ga0466690_218913 | 3300042590 | Unclassified | 6452 |
| 79 | Ga0466695_040425 | 3300042595 | Bacteria | 7890 |
| 80 | Ga0466696_015286 | 3300042596 | Bacteria | 9512 |
| 81 | 2227538697 | 2225789004 | Bacteria | 611 |
| 82 | HBC_ctgsDRAFT_1026477 | 3300000333 | Unclassified | 1423 |
| 83 | Ga0068305_10001727 | 3300005083 | Unclassified | 3711 |
| 84 | Ga0068305_10002005 | 3300005083 | Unclassified | 14847 |
| 85 | Ga0466711_157262 | 3300042615 | Bacteria | 14003 |
| 86 | Ga0466715_391873 | 3300042616 | Bacteria | 1048 |
| 87 | Ga0466726_152950 | 3300042619 | Unclassified | 15247 |
| 88 | Ga0466726_338996 | 3300042619 | Bacteria | 5681 |
| 89 | Ga0466726_387681 | 3300042619 | Bacteria | 2019 |
| 90 | Ga0123353_10068371 | 3300010167 | Bacteria | 5704 |
| 91 | Ga0123353_10286049 | 3300010167 | Bacteria | 2528 |
| 92 | Ga0123353_10514364 | 3300010167 | Bacteria | 1739 |
| 93 | Ga0123353_12934075 | 3300010167 | Bacteria | 554 |
| 94 | Ga0466703_268703 | 3300042636 | Bacteria | 10389 |
| 95 | Ga0466708_025171 | 3300042652 | Unclassified | 34338 |
| 96 | Ga0466727_189108 | 3300042655 | Bacteria | 11877 |
| 97 | Ga0466705_056233 | 3300042612 | Bacteria | 3521 |
| 98 | Ga0466707_093501 | 3300042601 | Bacteria | 14748 |
| 99 | Ga0466707_251895 | 3300042601 | Bacteria | 2613 |
| 100 | Ga0466716_212757 | 3300042605 | Bacteria | 1979 |
| 101 | Ga0160468_115093 | 3300012819 | Bacteria | 702 |
| 102 | Ga0466690_410627 | 3300042590 | Bacteria | 3708 |
| 103 | Ga0466691_055990 | 3300042593 | Bacteria | 16255 |
| 104 | Ga0466696_031843 | 3300042596 | Bacteria | 9420 |
| 105 | SCG598J21_11573 | 3300000475 | Bacteria | 13732 |
| 106 | JGI24702J35022_10061098 | 3300002462 | Bacteria | 2015 |
| 107 | Ga0466711_093162 | 3300042615 | Bacteria | 19638 |
| 108 | Ga0466711_412363 | 3300042615 | Unclassified | 14157 |
| 109 | Ga0466715_044590 | 3300042616 | Bacteria | 10561 |
| 110 | Ga0466728_327386 | 3300042620 | Unclassified | 17345 |
| 111 | Ga0123354_10453992 | 3300010882 | Bacteria | 1035 |
| 112 | Ga0466735_144860 | 3300042624 | Bacteria | 2862 |
| 113 | Ga0466703_249168 | 3300042636 | Bacteria | 12929 |
| 114 | Ga0466705_121833 | 3300042612 | Bacteria | 15440 |
| 115 | Ga0466705_217388 | 3300042612 | Bacteria | 2491 |
| 116 | Ga0466705_335260 | 3300042612 | Unclassified | 1266 |
| 117 | Ga0466706_260282 | 3300042599 | Bacteria | 2803 |
| 118 | Ga0466707_058122 | 3300042601 | Bacteria | 23469 |
| 119 | Ga0466714_050092 | 3300042603 | Bacteria | 43548 |
| 120 | Ga0466696_377181 | 3300042596 | Bacteria | 59848 |
| 121 | JGI24696J40584_12959989 | 3300002834 | Bacteria | 6039 |
| 122 | Ga0466726_251535 | 3300042619 | Bacteria | 6616 |
| 123 | Ga0466726_336815 | 3300042619 | Bacteria | 12910 |
| 124 | Ga0466728_341550 | 3300042620 | Bacteria | 38650 |
| 125 | Ga0123356_11264097 | 3300010049 | Bacteria | 902 |
| 126 | Ga0160464_100196 | 3300012805 | Bacteria | 61467 |
| 127 | Ga0466735_074310 | 3300042624 | Bacteria | 1284 |
| 128 | Ga0466703_348168 | 3300042636 | Bacteria | 8397 |
| 129 | Ga0466708_181389 | 3300042652 | Bacteria | 30464 |
| 130 | Ga0466727_224885 | 3300042655 | Bacteria | 1447 |
| 131 | Ga0466705_041236 | 3300042612 | Bacteria | 17123 |
| 132 | Ga0466713_088138 | 3300042602 | Bacteria | 12525 |
| 133 | Ga0466716_132168 | 3300042605 | Bacteria | 13249 |
| 134 | Ga0264413_150896 | 3300024493 | Bacteria | 4121 |
| 135 | Ga0466691_023000 | 3300042593 | Bacteria | 2095 |
| 136 | IMNBL1DRAFT_c0025046 | 3300000062 | Unclassified | 2296 |
| 137 | JGI24695J34938_10145618 | 3300002450 | Bacteria | 969 |
| 138 | Ga0466715_394436 | 3300042616 | Bacteria | 12319 |
| 139 | Ga0466726_142158 | 3300042619 | Bacteria | 14266 |
| 140 | Ga0466726_424887 | 3300042619 | Bacteria | 1061 |
| 141 | Ga0466726_439357 | 3300042619 | Bacteria | 2076 |
| 142 | Ga0466729_048527 | 3300042621 | Bacteria | 1981 |
| 143 | Ga0123357_10038458 | 3300009784 | Bacteria | 6514 |
| 144 | Ga0123355_11280059 | 3300009826 | Bacteria | 738 |
| 145 | Ga0123356_10328030 | 3300010049 | Bacteria | 1646 |
| 146 | Ga0123353_12618954 | 3300010167 | Bacteria | 596 |
| 147 | Ga0466735_232979 | 3300042624 | Bacteria | 1997 |
| 148 | Ga0466703_019759 | 3300042636 | Bacteria | 14140 |
| 149 | Ga0466704_212386 | 3300042643 | Unclassified | 2263 |
| 150 | Ga0466727_194661 | 3300042655 | Bacteria | 11133 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.