Protein Family IF09377
Metagenome
Metatranscriptome
Isolate
224
Members
51
Samples
217
Scaffolds
234.28
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_132165|Ga0466704_132165_28093_28914
- Length
- 273 aa
- Sequence
- MPGAPGKERAEKVYGPPEKPVPAHVGIIMDGNGRWAQSRGLPRTQGHLEGLKAAKRIVKAASDLGILYLTLYVFSTENWKRAGEEVGFIMSLIKKYLRGELNFYRENRIRIRHAGDPAGLSPDIVADLRTAAEDTKNFGGMQVILALNYGGRDEIVRALRRFAKDAGSGICPGGSVTEEAIRARLDNPDVPDPDLVVRTAGEFRISNFLLWEGAYAEYVISPKLWPDFTEEDLVLAVNDYRNRDRRFGGIVSAERGFNAGKETRPAEKARADG
Sample Types
Isolate
3.1%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.7%
Kalotermitidae
28.6%
Unclassified
16.3%
Rhinotermitidae
8.2%
Termopsidae
6.1%
Apidae
4.1%
Hodotermitidae
2.0%
Taxonomy
Archaea
0
Bacteria
219
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 2 | 2791354941 | Bombella intestini R-52487 | Isolate | Unclassified |
| 3 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 4 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 5 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 6 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 7 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 8 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 9 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 10 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 11 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 14 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 20 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300021235 | Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA | Metatranscriptome | |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 37 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 38 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 39 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 40 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 2834160066 | Parasaccharibacter apium B8 | Isolate | Apidae |
| 47 | 2920413932 | Bombella sp. ESL0380 | Isolate | Apidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 50 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 51 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_039978 | 3300038395 | Bacteria | 2222 |
| 2 | Ga0466691_111394 | 3300042593 | Bacteria | 1361 |
| 3 | Ga0466691_121500 | 3300042593 | Bacteria | 8749 |
| 4 | Ga0466694_171615 | 3300042594 | Bacteria | 1026 |
| 5 | Ga0466696_137087 | 3300042596 | Bacteria | 42498 |
| 6 | Ga0466705_499395 | 3300042612 | Bacteria | 13774 |
| 7 | Ga0466711_504790 | 3300042615 | Bacteria | 5181 |
| 8 | Ga0466715_023724 | 3300042616 | Bacteria | 15101 |
| 9 | Ga0466715_031059 | 3300042616 | Bacteria | 29297 |
| 10 | Ga0466718_045827 | 3300042617 | Bacteria | 2349 |
| 11 | Ga0466723_230198 | 3300042618 | Bacteria | 8043 |
| 12 | Ga0466726_015760 | 3300042619 | Bacteria | 18261 |
| 13 | Ga0466728_185570 | 3300042620 | Bacteria | 18516 |
| 14 | JGI24698J34947_10030911 | 3300002449 | Unclassified | 2821 |
| 15 | Ga0466706_222133 | 3300042599 | Bacteria | 1729 |
| 16 | Ga0466719_385328 | 3300042606 | Bacteria | 1358 |
| 17 | Ga0466703_200680 | 3300042636 | Bacteria | 50831 |
| 18 | Ga0466704_163614 | 3300042643 | Bacteria | 3323 |
| 19 | Ga0466704_165897 | 3300042643 | Bacteria | 4954 |
| 20 | Ga0466708_133016 | 3300042652 | Bacteria | 45331 |
| 21 | Ga0466708_279571 | 3300042652 | Bacteria | 4449 |
| 22 | Ga0466727_227422 | 3300042655 | Bacteria | 2379 |
| 23 | Ga0466705_348832 | 3300042612 | Bacteria | 18922 |
| 24 | Ga0264413_122810 | 3300024493 | Bacteria | 4846 |
| 25 | Ga0466690_159409 | 3300042590 | Bacteria | 7401 |
| 26 | Ga0466690_418645 | 3300042590 | Bacteria | 20827 |
| 27 | Ga0466692_126116 | 3300042591 | Bacteria | 2302 |
| 28 | Ga0466696_289529 | 3300042596 | Bacteria | 2324 |
| 29 | Ga0466705_475276 | 3300042612 | Bacteria | 13046 |
| 30 | Ga0466711_037161 | 3300042615 | Bacteria | 9971 |
| 31 | Ga0466711_383350 | 3300042615 | Bacteria | 21821 |
| 32 | Ga0466715_303747 | 3300042616 | Bacteria | 3446 |
| 33 | Ga0466726_113057 | 3300042619 | Bacteria | 5324 |
| 34 | Ga0466728_074177 | 3300042620 | Bacteria | 1092 |
| 35 | Ga0123355_10069752 | 3300009826 | Bacteria | 5649 |
| 36 | Ga0123353_10834296 | 3300010167 | Bacteria | 1266 |
| 37 | JGI24698J34947_10005635 | 3300002449 | Bacteria | 6865 |
| 38 | Ga0466716_021401 | 3300042605 | Bacteria | 18251 |
| 39 | Ga0466716_444984 | 3300042605 | Bacteria | 4450 |
| 40 | Ga0466720_096476 | 3300042607 | Bacteria | 16263 |
| 41 | Ga0466722_144391 | 3300042609 | Bacteria | 6608 |
| 42 | Ga0466722_205993 | 3300042609 | Bacteria | 9571 |
| 43 | Ga0466722_237936 | 3300042609 | Bacteria | 3877 |
| 44 | Ga0466729_227478 | 3300042621 | Bacteria | 1519 |
| 45 | Ga0466704_200549 | 3300042643 | Bacteria | 2441 |
| 46 | Ga0466704_288422 | 3300042643 | Bacteria | 11514 |
| 47 | Ga0466708_031869 | 3300042652 | Bacteria | 25889 |
| 48 | Ga0466708_155501 | 3300042652 | Bacteria | 1370 |
| 49 | Ga0466727_075726 | 3300042655 | Bacteria | 3305 |
| 50 | Ga0466727_186927 | 3300042655 | Bacteria | 2333 |
| 51 | Ga0466727_281507 | 3300042655 | Bacteria | 6003 |
| 52 | Ga0466705_019159 | 3300042612 | Bacteria | 6838 |
| 53 | Ga0466705_134074 | 3300042612 | Bacteria | 5593 |
| 54 | Ga0456237_0001202 | 3300041968 | Unclassified | 4086 |
| 55 | Ga0466692_190677 | 3300042591 | Bacteria | 12373 |
| 56 | Ga0466691_086049 | 3300042593 | Bacteria | 30046 |
| 57 | Ga0466691_125072 | 3300042593 | Bacteria | 14179 |
| 58 | Ga0466694_328676 | 3300042594 | Bacteria | 1804 |
| 59 | Ga0466696_044117 | 3300042596 | Bacteria | 1318 |
| 60 | Ga0466696_450427 | 3300042596 | Bacteria | 17307 |
| 61 | Ga0466705_472624 | 3300042612 | Bacteria | 2784 |
| 62 | Ga0466711_062881 | 3300042615 | Bacteria | 6265 |
| 63 | Ga0466711_372171 | 3300042615 | Bacteria | 1307 |
| 64 | Ga0466711_373336 | 3300042615 | Bacteria | 1274 |
| 65 | Ga0466715_249785 | 3300042616 | Bacteria | 7306 |
| 66 | Ga0466718_103835 | 3300042617 | Bacteria | 10329 |
| 67 | Ga0466723_331635 | 3300042618 | Bacteria | 5570 |
| 68 | JGI24698J34947_10087519 | 3300002449 | Bacteria | 1440 |
| 69 | Ga0466713_028212 | 3300042602 | Bacteria | 5051 |
| 70 | Ga0466716_168824 | 3300042605 | Bacteria | 1936 |
| 71 | Ga0466719_111483 | 3300042606 | Bacteria | 12057 |
| 72 | Ga0466719_444651 | 3300042606 | Bacteria | 35344 |
| 73 | Ga0466722_137734 | 3300042609 | Bacteria | 7087 |
| 74 | Ga0466722_143123 | 3300042609 | Bacteria | 18058 |
| 75 | Ga0466702_241505 | 3300042635 | Bacteria | 1995 |
| 76 | Ga0466704_527647 | 3300042643 | Bacteria | 2633 |
| 77 | Ga0466709_015809 | 3300042648 | Bacteria | 82452 |
| 78 | Ga0466709_261143 | 3300042648 | Bacteria | 5530 |
| 79 | Ga0466708_028258 | 3300042652 | Bacteria | 15218 |
| 80 | Ga0466708_088164 | 3300042652 | Bacteria | 5012 |
| 81 | Ga0466727_206935 | 3300042655 | Bacteria | 2397 |
| 82 | Ga0456237_0002756 | 3300041968 | Bacteria | 2842 |
| 83 | Ga0466692_039371 | 3300042591 | Bacteria | 2695 |
| 84 | Ga0466692_108071 | 3300042591 | Bacteria | 9633 |
| 85 | Ga0466691_012510 | 3300042593 | Bacteria | 4245 |
| 86 | Ga0466695_151841 | 3300042595 | Bacteria | 41232 |
| 87 | Ga0466696_221912 | 3300042596 | Bacteria | 24962 |
| 88 | Ga0466718_062523 | 3300042617 | Bacteria | 1888 |
| 89 | Ga0466723_070395 | 3300042618 | Bacteria | 6618 |
| 90 | Ga0466723_125967 | 3300042618 | Bacteria | 1830 |
| 91 | Ga0466726_260361 | 3300042619 | Bacteria | 3661 |
| 92 | Ga0466728_096533 | 3300042620 | Bacteria | 8998 |
| 93 | Ga0068305_10032775 | 3300005083 | Unclassified | 4672 |
| 94 | Ga0074263_103828 | 3300005485 | Bacteria | 1262 |
| 95 | Ga0466700_342511 | 3300042600 | Bacteria | 1050 |
| 96 | Ga0466713_112879 | 3300042602 | Bacteria | 6615 |
| 97 | Ga0466717_139981 | 3300042604 | Bacteria | 1071 |
| 98 | Ga0466717_210812 | 3300042604 | Bacteria | 1239 |
| 99 | Ga0466719_275687 | 3300042606 | Bacteria | 37707 |
| 100 | Ga0466720_036617 | 3300042607 | Bacteria | 2941 |
| 101 | Ga0466722_008893 | 3300042609 | Bacteria | 12391 |
| 102 | Ga0466703_326813 | 3300042636 | Bacteria | 78531 |
| 103 | Ga0466709_262981 | 3300042648 | Bacteria | 44599 |
| 104 | Ga0466708_264944 | 3300042652 | Bacteria | 11542 |
| 105 | Ga0466727_301540 | 3300042655 | Bacteria | 3695 |
| 106 | Ga0466705_182822 | 3300042612 | Bacteria | 4992 |
| 107 | Ga0466690_035095 | 3300042590 | Bacteria | 1248 |
| 108 | Ga0466692_018826 | 3300042591 | Bacteria | 20530 |
| 109 | Ga0466694_209764 | 3300042594 | Bacteria | 3574 |
| 110 | Ga0466712_019025 | 3300042614 | Bacteria | 3256 |
| 111 | Ga0466711_280204 | 3300042615 | Bacteria | 21555 |
| 112 | Ga0466715_041382 | 3300042616 | Bacteria | 5685 |
| 113 | Ga0466715_438304 | 3300042616 | Bacteria | 15591 |
| 114 | Ga0466726_196740 | 3300042619 | Bacteria | 4893 |
| 115 | Ga0123355_10024942 | 3300009826 | Bacteria | 9620 |
| 116 | Ga0123353_10179205 | 3300010167 | Bacteria | 3357 |
| 117 | Ga0123353_10360530 | 3300010167 | Bacteria | 2185 |
| 118 | Ga0123354_10245959 | 3300010882 | Bacteria | 1827 |
| 119 | Ga0466706_018873 | 3300042599 | Bacteria | 1053 |
| 120 | Ga0466706_126175 | 3300042599 | Bacteria | 1475 |
| 121 | Ga0466707_309956 | 3300042601 | Bacteria | 1236 |
| 122 | Ga0466707_416519 | 3300042601 | Bacteria | 2278 |
| 123 | Ga0466713_144458 | 3300042602 | Bacteria | 1290 |
| 124 | Ga0466720_097910 | 3300042607 | Bacteria | 1068 |
| 125 | Ga0466722_004303 | 3300042609 | Bacteria | 62419 |
| 126 | Ga0466722_060023 | 3300042609 | Bacteria | 4584 |
| 127 | Ga0466722_211970 | 3300042609 | Bacteria | 12844 |
| 128 | Ga0466698_020306 | 3300042610 | Bacteria | 1051 |
| 129 | Ga0466703_337384 | 3300042636 | Bacteria | 14779 |
| 130 | Ga0466704_597712 | 3300042643 | Bacteria | 1301 |
| 131 | Ga0466709_022367 | 3300042648 | Bacteria | 18662 |
| 132 | Ga0466708_187629 | 3300042652 | Bacteria | 7619 |
| 133 | Ga0466708_215966 | 3300042652 | Bacteria | 9299 |
| 134 | Ga0466708_311551 | 3300042652 | Bacteria | 2712 |
| 135 | Ga0466727_256586 | 3300042655 | Bacteria | 2265 |
| 136 | Ga0466727_308569 | 3300042655 | Bacteria | 2865 |
| 137 | Ga0466705_357506 | 3300042612 | Bacteria | 14028 |
| 138 | Ga0466732_349140 | 3300042656 | Bacteria | 1114 |
| 139 | Ga0466715_343051 | 3300042616 | Bacteria | 13914 |
| 140 | Ga0466723_036819 | 3300042618 | Bacteria | 9481 |
| 141 | Ga0466723_082453 | 3300042618 | Bacteria | 72592 |
| 142 | Ga0466723_231827 | 3300042618 | Bacteria | 2618 |
| 143 | Ga0466723_250429 | 3300042618 | Bacteria | 18123 |
| 144 | Ga0466726_110368 | 3300042619 | Bacteria | 1869 |
| 145 | Ga0466726_347405 | 3300042619 | Bacteria | 3676 |
| 146 | Ga0466728_071311 | 3300042620 | Bacteria | 1723 |
| 147 | Ga0123355_10006907 | 3300009826 | Bacteria | 16897 |
| 148 | Ga0123355_10074279 | 3300009826 | Bacteria | 5446 |
| 149 | Ga0123355_10681823 | 3300009826 | Bacteria | 1187 |
| 150 | Ga0123353_10651470 | 3300010167 | Bacteria | 1491 |
| 151 | JGI24698J34947_10030066 | 3300002449 | Bacteria | 2866 |
| 152 | JGI24698J34947_10083105 | 3300002449 | Unclassified | 1495 |
| 153 | Ga0466717_265351 | 3300042604 | Bacteria | 1172 |
| 154 | Ga0466716_078982 | 3300042605 | Bacteria | 1631 |
| 155 | Ga0466716_264113 | 3300042605 | Bacteria | 2764 |
| 156 | Ga0466719_052781 | 3300042606 | Bacteria | 1539 |
| 157 | Ga0466719_218641 | 3300042606 | Bacteria | 6945 |
| 158 | Ga0466703_117146 | 3300042636 | Bacteria | 17491 |
| 159 | Ga0466703_159061 | 3300042636 | Bacteria | 19395 |
| 160 | Ga0466704_163676 | 3300042643 | Bacteria | 22512 |
| 161 | Ga0466704_168830 | 3300042643 | Bacteria | 7731 |
| 162 | Ga0466708_009999 | 3300042652 | Bacteria | 25991 |
| 163 | Ga0466705_050150 | 3300042612 | Bacteria | 30586 |
| 164 | Ga0466705_381407 | 3300042612 | Bacteria | 18649 |
| 165 | Ga0466732_362013 | 3300042656 | Bacteria | 4987 |
| 166 | Ga0466696_177152 | 3300042596 | Bacteria | 8863 |
| 167 | Ga0466705_496353 | 3300042612 | Unclassified | 4848 |
| 168 | Ga0466711_068080 | 3300042615 | Bacteria | 1215 |
| 169 | Ga0466711_138141 | 3300042615 | Bacteria | 2311 |
| 170 | Ga0466715_120929 | 3300042616 | Bacteria | 51611 |
| 171 | Ga0466715_630959 | 3300042616 | Bacteria | 20029 |
| 172 | Ga0466723_049536 | 3300042618 | Bacteria | 40266 |
| 173 | Ga0466723_185275 | 3300042618 | Bacteria | 4342 |
| 174 | Ga0466726_195389 | 3300042619 | Bacteria | 1138 |
| 175 | Ga0466728_171577 | 3300042620 | Bacteria | 15599 |
| 176 | Ga0123355_10712504 | 3300009826 | Bacteria | 1148 |
| 177 | Ga0123353_10403554 | 3300010167 | Bacteria | 2033 |
| 178 | Ga0123353_10728003 | 3300010167 | Bacteria | 1386 |
| 179 | Ga0123353_10820434 | 3300010167 | Bacteria | 1281 |
| 180 | Ga0466700_451608 | 3300042600 | Bacteria | 3071 |
| 181 | Ga0466707_352746 | 3300042601 | Bacteria | 1047 |
| 182 | Ga0466719_138593 | 3300042606 | Bacteria | 3098 |
| 183 | Ga0466719_377642 | 3300042606 | Bacteria | 21657 |
| 184 | Ga0466719_390576 | 3300042606 | Bacteria | 14580 |
| 185 | Ga0466722_013370 | 3300042609 | Bacteria | 3679 |
| 186 | Ga0466722_088017 | 3300042609 | Bacteria | 28999 |
| 187 | Ga0466731_378724 | 3300042622 | Bacteria | 1445 |
| 188 | Ga0466735_133750 | 3300042624 | Bacteria | 2157 |
| 189 | Ga0466735_161389 | 3300042624 | Bacteria | 1301 |
| 190 | Ga0466703_132938 | 3300042636 | Bacteria | 17353 |
| 191 | Ga0466704_132165 | 3300042643 | Bacteria | 35160 |
| 192 | Ga0466709_331465 | 3300042648 | Bacteria | 3471 |
| 193 | Ga0466709_369052 | 3300042648 | Bacteria | 6450 |
| 194 | Ga0466708_072964 | 3300042652 | Bacteria | 3971 |
| 195 | Ga0466708_103796 | 3300042652 | Bacteria | 41820 |
| 196 | Ga0223674_1007231 | 3300021235 | Bacteria | 1747 |
| 197 | Ga0466690_190992 | 3300042590 | Bacteria | 16363 |
| 198 | Ga0466690_301774 | 3300042590 | Bacteria | 4698 |
| 199 | Ga0466694_082548 | 3300042594 | Bacteria | 2459 |
| 200 | Ga0466694_323695 | 3300042594 | Bacteria | 1659 |
| 201 | Ga0466694_400240 | 3300042594 | Bacteria | 1381 |
| 202 | Ga0466696_434415 | 3300042596 | Bacteria | 1277 |
| 203 | Ga0466726_098881 | 3300042619 | Bacteria | 3960 |
| 204 | Ga0466726_396707 | 3300042619 | Bacteria | 3069 |
| 205 | Ga0123353_10432774 | 3300010167 | Bacteria | 1945 |
| 206 | JGI24698J34947_10053058 | 3300002449 | Bacteria | 2031 |
| 207 | Ga0466716_022210 | 3300042605 | Bacteria | 20428 |
| 208 | Ga0466719_194360 | 3300042606 | Bacteria | 2232 |
| 209 | Ga0466719_243244 | 3300042606 | Bacteria | 5366 |
| 210 | Ga0466722_047883 | 3300042609 | Bacteria | 1933 |
| 211 | Ga0466722_252418 | 3300042609 | Bacteria | 17603 |
| 212 | Ga0466703_113738 | 3300042636 | Bacteria | 1000 |
| 213 | Ga0466704_308552 | 3300042643 | Bacteria | 41896 |
| 214 | Ga0466704_395254 | 3300042643 | Bacteria | 7337 |
| 215 | Ga0466709_202948 | 3300042648 | Bacteria | 1917 |
| 216 | Ga0466709_419941 | 3300042648 | Bacteria | 3539 |
| 217 | Ga0466727_074740 | 3300042655 | Bacteria | 2664 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01255 | Prenyltransf | Putative undecaprenyl diphosphate synthase | 28 | 248 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01255 | GO:0016765 | transferase activity, transferring alkyl or aryl (other than methyl) groups | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.