Protein Family IF09372
Metagenome
Metatranscriptome
Isolate
221
Members
65
Samples
216
Scaffolds
254.24
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_124059|Ga0466704_124059_1494_2255
- Length
- 240 aa
- Sequence
- MDVKEIIKPENMVYGKSPVLTDVVMHYCPGCSHGAIHKLIAEVIEEMGIQEKTIGISPVGCAVFAYNYLHIDWQQAAHGRAPALATATKRLYPDKYVFTYQGDGDLAAIGTAETIHACNRGENIVIIFVNNAIYGMTGGQMSPLTIEGQVTATTPYGRRTDLNGYSLKITDLVAQLEGTCYVTRQSVQKAFENSANGKGTSFIEVVSSCNSGWKLTPVAANKWMEENLFPFYPLGDLKDN
Sample Types
Isolate
2.3%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.4%
Kalotermitidae
22.6%
Unclassified
12.9%
Rhinotermitidae
6.5%
Termopsidae
4.8%
Passalidae
3.2%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
202
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 27 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 28 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300021222 | Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA | Metatranscriptome | |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 41 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 46 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 47 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 48 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 49 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 50 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 58 | 3300021232 | Termite gut microbial communities from nest from French Guiana - FG16_14_4 mRNA SA | Metatranscriptome | |
| 59 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_125056 | 3300042612 | Bacteria | 16098 |
| 2 | Ga0466733_004084 | 3300042659 | Bacteria | 2047 |
| 3 | Ga0466700_156416 | 3300042600 | Bacteria | 1495 |
| 4 | Ga0466722_023479 | 3300042609 | Bacteria | 103035 |
| 5 | Ga0466722_249823 | 3300042609 | Bacteria | 11103 |
| 6 | Ga0466729_217293 | 3300042621 | Bacteria | 5729 |
| 7 | Ga0466731_230663 | 3300042622 | Bacteria | 1259 |
| 8 | Ga0466735_105515 | 3300042624 | Bacteria | 7803 |
| 9 | Ga0466735_152364 | 3300042624 | Bacteria | 4491 |
| 10 | Ga0466727_083489 | 3300042655 | Bacteria | 12885 |
| 11 | Ga0466657_040173 | 3300042582 | Bacteria | 1166 |
| 12 | Ga0466692_014409 | 3300042591 | Bacteria | 9364 |
| 13 | Ga0466692_139009 | 3300042591 | Bacteria | 2240 |
| 14 | Ga0466696_063545 | 3300042596 | Bacteria | 24327 |
| 15 | Ga0466696_079488 | 3300042596 | Bacteria | 14962 |
| 16 | Ga0466711_095177 | 3300042615 | Bacteria | 4586 |
| 17 | Ga0466723_253149 | 3300042618 | Bacteria | 9220 |
| 18 | Ga0123355_10000037 | 3300009826 | Bacteria | 130470 |
| 19 | Ga0123356_10458979 | 3300010049 | Bacteria | 1423 |
| 20 | Ga0123353_10439774 | 3300010167 | Bacteria | 1924 |
| 21 | Ga0123354_10182218 | 3300010882 | Bacteria | 2392 |
| 22 | Ga0123354_10186494 | 3300010882 | Bacteria | 2344 |
| 23 | Ga0123354_10399397 | 3300010882 | Bacteria | 1165 |
| 24 | JGI24695J34938_10067777 | 3300002450 | Unclassified | 1500 |
| 25 | JGI24702J35022_10017754 | 3300002462 | Bacteria | 3884 |
| 26 | JGI24702J35022_10069776 | 3300002462 | Bacteria | 1891 |
| 27 | Ga0072941_1188516 | 3300005201 | Bacteria | 2849 |
| 28 | Ga0466732_164326 | 3300042656 | Bacteria | 2725 |
| 29 | Ga0466732_421119 | 3300042656 | Bacteria | 54820 |
| 30 | Ga0466713_090462 | 3300042602 | Bacteria | 11495 |
| 31 | Ga0466714_005923 | 3300042603 | Bacteria | 11012 |
| 32 | Ga0466722_189570 | 3300042609 | Bacteria | 5156 |
| 33 | Ga0466698_001141 | 3300042610 | Bacteria | 1205 |
| 34 | Ga0466698_510775 | 3300042610 | Bacteria | 1639 |
| 35 | Ga0466697_000883 | 3300042611 | Bacteria | 2737 |
| 36 | Ga0466735_190032 | 3300042624 | Bacteria | 1254 |
| 37 | Ga0466703_077922 | 3300042636 | Bacteria | 14196 |
| 38 | Ga0466703_143120 | 3300042636 | Bacteria | 14478 |
| 39 | Ga0466703_331251 | 3300042636 | Bacteria | 17749 |
| 40 | Ga0466704_281081 | 3300042643 | Bacteria | 1702 |
| 41 | Ga0466724_68671 | 3300042649 | Bacteria | 1155 |
| 42 | Ga0466690_179622 | 3300042590 | Bacteria | 23164 |
| 43 | Ga0466692_083784 | 3300042591 | Bacteria | 2167 |
| 44 | Ga0466693_112312 | 3300042592 | Bacteria | 4297 |
| 45 | Ga0466710_329267 | 3300042613 | Bacteria | 2475 |
| 46 | Ga0466715_384196 | 3300042616 | Bacteria | 8401 |
| 47 | Ga0466718_010857 | 3300042617 | Unclassified | 1390 |
| 48 | Ga0466723_085607 | 3300042618 | Bacteria | 23658 |
| 49 | Ga0466729_126418 | 3300042621 | Bacteria | 1857 |
| 50 | Ga0123356_10075730 | 3300010049 | Bacteria | 3170 |
| 51 | Ga0123356_11178734 | 3300010049 | Bacteria | 933 |
| 52 | Ga0123353_10260121 | 3300010167 | Bacteria | 2681 |
| 53 | Ga0123353_10325534 | 3300010167 | Bacteria | 2330 |
| 54 | Ga0123353_10336362 | 3300010167 | Bacteria | 2283 |
| 55 | Ga0123354_10055269 | 3300010882 | Unclassified | 5944 |
| 56 | Ga0123354_10112501 | 3300010882 | Bacteria | 3583 |
| 57 | Ga0466705_153641 | 3300042612 | Bacteria | 3997 |
| 58 | Ga0466732_398646 | 3300042656 | Bacteria | 1628 |
| 59 | Ga0466733_055889 | 3300042659 | Bacteria | 1476 |
| 60 | Ga0466706_134888 | 3300042599 | Bacteria | 15757 |
| 61 | Ga0466714_050501 | 3300042603 | Bacteria | 1924 |
| 62 | Ga0466716_027681 | 3300042605 | Bacteria | 1770 |
| 63 | Ga0466719_158932 | 3300042606 | Bacteria | 9465 |
| 64 | Ga0466719_276033 | 3300042606 | Bacteria | 9562 |
| 65 | Ga0466719_354194 | 3300042606 | Bacteria | 2671 |
| 66 | Ga0466722_062607 | 3300042609 | Bacteria | 3730 |
| 67 | Ga0466698_419574 | 3300042610 | Bacteria | 3238 |
| 68 | Ga0466734_004266 | 3300042623 | Bacteria | 1118 |
| 69 | Ga0466704_599220 | 3300042643 | Unclassified | 5918 |
| 70 | Ga0466727_106023 | 3300042655 | Bacteria | 80602 |
| 71 | Ga0466694_366607 | 3300042594 | Bacteria | 2039 |
| 72 | Ga0466696_256314 | 3300042596 | Bacteria | 5299 |
| 73 | Ga0466705_529005 | 3300042612 | Bacteria | 4398 |
| 74 | Ga0466711_402437 | 3300042615 | Bacteria | 10227 |
| 75 | Ga0466715_196659 | 3300042616 | Bacteria | 14545 |
| 76 | Ga0466723_125525 | 3300042618 | Bacteria | 14542 |
| 77 | Ga0466726_065998 | 3300042619 | Bacteria | 18305 |
| 78 | Ga0466729_007879 | 3300042621 | Bacteria | 30241 |
| 79 | Ga0466729_133235 | 3300042621 | Bacteria | 11855 |
| 80 | Ga0123356_10513675 | 3300010049 | Bacteria | 1355 |
| 81 | Ga0123353_10042872 | 3300010167 | Bacteria | 7161 |
| 82 | Ga0123354_10040335 | 3300010882 | Bacteria | 7224 |
| 83 | Ga0123354_10121208 | 3300010882 | Bacteria | 3376 |
| 84 | Ga0466733_086518 | 3300042659 | Bacteria | 10515 |
| 85 | Ga0466707_382192 | 3300042601 | Bacteria | 1460 |
| 86 | Ga0466713_059567 | 3300042602 | Bacteria | 80935 |
| 87 | Ga0466713_138201 | 3300042602 | Bacteria | 41853 |
| 88 | Ga0466714_032626 | 3300042603 | Bacteria | 14919 |
| 89 | Ga0466714_126828 | 3300042603 | Bacteria | 5656 |
| 90 | Ga0466722_037614 | 3300042609 | Bacteria | 16563 |
| 91 | Ga0466704_350333 | 3300042643 | Bacteria | 20772 |
| 92 | Ga0466708_127362 | 3300042652 | Bacteria | 3315 |
| 93 | Ga0466708_368954 | 3300042652 | Unclassified | 6722 |
| 94 | Ga0456237_0000001 | 3300041968 | Bacteria | 140796 |
| 95 | Ga0466696_290896 | 3300042596 | Bacteria | 49735 |
| 96 | Ga0466699_432843 | 3300042597 | Bacteria | 1950 |
| 97 | Ga0466711_008631 | 3300042615 | Bacteria | 3377 |
| 98 | Ga0466715_493763 | 3300042616 | Bacteria | 2304 |
| 99 | Ga0123356_10144856 | 3300010049 | Bacteria | 2349 |
| 100 | Ga0123356_10803945 | 3300010049 | Bacteria | 1111 |
| 101 | Ga0123356_10911499 | 3300010049 | Bacteria | 1050 |
| 102 | Ga0123353_10174555 | 3300010167 | Bacteria | 3408 |
| 103 | 2227447191 | 2225789004 | Bacteria | 1018 |
| 104 | IMNBL1DRAFT_c0007401 | 3300000062 | Bacteria | 5779 |
| 105 | Ga0068305_10486338 | 3300005083 | Bacteria | 2611 |
| 106 | Ga0466706_110931 | 3300042599 | Bacteria | 2641 |
| 107 | Ga0466707_106816 | 3300042601 | Bacteria | 2558 |
| 108 | Ga0466707_412602 | 3300042601 | Bacteria | 1877 |
| 109 | Ga0466719_563778 | 3300042606 | Bacteria | 20517 |
| 110 | Ga0466731_371466 | 3300042622 | Bacteria | 1072 |
| 111 | Ga0466735_014175 | 3300042624 | Bacteria | 6184 |
| 112 | Ga0466709_370540 | 3300042648 | Bacteria | 10300 |
| 113 | Ga0466657_388957 | 3300042582 | Bacteria | 1196 |
| 114 | Ga0466693_035705 | 3300042592 | Bacteria | 1489 |
| 115 | Ga0466693_077110 | 3300042592 | Bacteria | 5597 |
| 116 | Ga0466691_089325 | 3300042593 | Bacteria | 13196 |
| 117 | Ga0466694_156591 | 3300042594 | Bacteria | 1608 |
| 118 | Ga0466715_120130 | 3300042616 | Bacteria | 18741 |
| 119 | Ga0466726_411896 | 3300042619 | Bacteria | 2007 |
| 120 | Ga0123355_10434821 | 3300009826 | Bacteria | 1666 |
| 121 | Ga0123353_10001287 | 3300010167 | Bacteria | 30743 |
| 122 | Ga0123353_10249949 | 3300010167 | Bacteria | 2747 |
| 123 | Ga0123354_10029065 | 3300010882 | Bacteria | 8701 |
| 124 | Ga0466697_147034 | 3300042611 | Bacteria | 1230 |
| 125 | Ga0466697_172700 | 3300042611 | Bacteria | 1604 |
| 126 | Ga0466705_226396 | 3300042612 | Bacteria | 7133 |
| 127 | Ga0466700_294863 | 3300042600 | Bacteria | 2801 |
| 128 | Ga0466714_082723 | 3300042603 | Bacteria | 1255 |
| 129 | Ga0466716_024964 | 3300042605 | Bacteria | 1707 |
| 130 | Ga0466719_348387 | 3300042606 | Bacteria | 4586 |
| 131 | Ga0466698_019070 | 3300042610 | Bacteria | 1518 |
| 132 | Ga0466735_099507 | 3300042624 | Bacteria | 5665 |
| 133 | Ga0466735_173600 | 3300042624 | Bacteria | 4757 |
| 134 | Ga0466730_016241 | 3300042625 | Bacteria | 1626 |
| 135 | Ga0466703_324667 | 3300042636 | Bacteria | 5861 |
| 136 | Ga0466704_124059 | 3300042643 | Bacteria | 2758 |
| 137 | Ga0466704_422083 | 3300042643 | Bacteria | 21259 |
| 138 | Ga0466709_339484 | 3300042648 | Bacteria | 169915 |
| 139 | Ga0466709_420440 | 3300042648 | Bacteria | 59570 |
| 140 | Ga0466724_01272 | 3300042649 | Unclassified | 6313 |
| 141 | Ga0223678_1003553 | 3300021222 | Bacteria | 839 |
| 142 | Ga0223676_1009878 | 3300021232 | Unclassified | 1099 |
| 143 | Ga0466692_114059 | 3300042591 | Bacteria | 7730 |
| 144 | Ga0466695_278362 | 3300042595 | Bacteria | 1442 |
| 145 | Ga0466695_371192 | 3300042595 | Bacteria | 14368 |
| 146 | Ga0466710_177810 | 3300042613 | Bacteria | 2199 |
| 147 | Ga0466710_361845 | 3300042613 | Bacteria | 1995 |
| 148 | Ga0466712_192570 | 3300042614 | Bacteria | 2438 |
| 149 | Ga0466715_383144 | 3300042616 | Bacteria | 2680 |
| 150 | Ga0466726_136943 | 3300042619 | Bacteria | 4377 |
| 151 | Ga0466728_409139 | 3300042620 | Unclassified | 2191 |
| 152 | Ga0123355_10000354 | 3300009826 | Bacteria | 59454 |
| 153 | Ga0123356_10012236 | 3300010049 | Bacteria | 8338 |
| 154 | Ga0123356_10030353 | 3300010049 | Unclassified | 5060 |
| 155 | Ga0123356_10103312 | 3300010049 | Bacteria | 2737 |
| 156 | Ga0123356_10817749 | 3300010049 | Unclassified | 1103 |
| 157 | Ga0123353_10090968 | 3300010167 | Bacteria | 4914 |
| 158 | JGI24702J35022_10001068 | 3300002462 | Bacteria | 17073 |
| 159 | Ga0466701_020846 | 3300042598 | Bacteria | 5776 |
| 160 | Ga0466701_100714 | 3300042598 | Bacteria | 26015 |
| 161 | Ga0466700_090012 | 3300042600 | Bacteria | 4812 |
| 162 | Ga0466707_107071 | 3300042601 | Bacteria | 2229 |
| 163 | Ga0466707_237114 | 3300042601 | Bacteria | 11966 |
| 164 | Ga0466707_400872 | 3300042601 | Bacteria | 56100 |
| 165 | Ga0466714_065512 | 3300042603 | Bacteria | 1224 |
| 166 | Ga0466722_106128 | 3300042609 | Bacteria | 6791 |
| 167 | Ga0466722_127247 | 3300042609 | Bacteria | 26149 |
| 168 | Ga0466731_122679 | 3300042622 | Bacteria | 1481 |
| 169 | Ga0466731_224814 | 3300042622 | Bacteria | 16033 |
| 170 | Ga0466735_083259 | 3300042624 | Bacteria | 1200 |
| 171 | Ga0466735_164759 | 3300042624 | Unclassified | 1950 |
| 172 | Ga0466703_164206 | 3300042636 | Bacteria | 7385 |
| 173 | Ga0466703_228828 | 3300042636 | Bacteria | 2724 |
| 174 | Ga0466704_364588 | 3300042643 | Unclassified | 6270 |
| 175 | Ga0466709_013292 | 3300042648 | Bacteria | 34325 |
| 176 | Ga0415639_234679 | 3300038395 | Bacteria | 1603 |
| 177 | Ga0466691_133014 | 3300042593 | Bacteria | 4233 |
| 178 | Ga0466694_251818 | 3300042594 | Bacteria | 2449 |
| 179 | Ga0466696_414941 | 3300042596 | Bacteria | 1041 |
| 180 | Ga0466715_392569 | 3300042616 | Bacteria | 7723 |
| 181 | Ga0466715_445638 | 3300042616 | Bacteria | 5402 |
| 182 | Ga0466726_118144 | 3300042619 | Bacteria | 5464 |
| 183 | Ga0123356_10033651 | 3300010049 | Bacteria | 4793 |
| 184 | Ga0123356_10493149 | 3300010049 | Unclassified | 1380 |
| 185 | Ga0123353_10169684 | 3300010167 | Unclassified | 3465 |
| 186 | Ga0123353_10383474 | 3300010167 | Bacteria | 2101 |
| 187 | Ga0123353_11354635 | 3300010167 | Bacteria | 919 |
| 188 | Ga0123354_10206707 | 3300010882 | Bacteria | 2137 |
| 189 | IMNBL1DRAFT_c0037120 | 3300000062 | Unclassified | 1693 |
| 190 | JGI24705J35276_12206481 | 3300002504 | Bacteria | 1722 |
| 191 | JGI24705J35276_12225039 | 3300002504 | Unclassified | 2675 |
| 192 | JGI24696J40584_12918961 | 3300002834 | Bacteria | 1327 |
| 193 | Ga0466705_223789 | 3300042612 | Bacteria | 6911 |
| 194 | Ga0466732_234508 | 3300042656 | Bacteria | 9038 |
| 195 | Ga0466733_080165 | 3300042659 | Bacteria | 23114 |
| 196 | Ga0466701_096398 | 3300042598 | Bacteria | 39327 |
| 197 | Ga0466707_053558 | 3300042601 | Bacteria | 5579 |
| 198 | Ga0466707_260122 | 3300042601 | Bacteria | 5581 |
| 199 | Ga0466714_139809 | 3300042603 | Bacteria | 5615 |
| 200 | Ga0466703_337563 | 3300042636 | Bacteria | 2158 |
| 201 | Ga0466704_011048 | 3300042643 | Bacteria | 31500 |
| 202 | Ga0466724_17572 | 3300042649 | Unclassified | 2731 |
| 203 | Ga0466725_347130 | 3300042654 | Bacteria | 1360 |
| 204 | Ga0466690_221347 | 3300042590 | Unclassified | 4087 |
| 205 | Ga0466692_008449 | 3300042591 | Bacteria | 3541 |
| 206 | Ga0466692_111348 | 3300042591 | Bacteria | 3579 |
| 207 | Ga0466710_382752 | 3300042613 | Bacteria | 1725 |
| 208 | Ga0466712_037439 | 3300042614 | Bacteria | 2314 |
| 209 | Ga0466723_229683 | 3300042618 | Bacteria | 7289 |
| 210 | Ga0466726_141457 | 3300042619 | Bacteria | 39794 |
| 211 | Ga0123357_10076936 | 3300009784 | Bacteria | 4404 |
| 212 | Ga0123356_10352422 | 3300010049 | Unclassified | 1596 |
| 213 | Ga0123353_10088698 | 3300010167 | Bacteria | 4981 |
| 214 | Ga0123354_10447141 | 3300010882 | Bacteria | 1050 |
| 215 | JGI24702J35022_10001135 | 3300002462 | Bacteria | 16563 |
| 216 | Ga0123357_10000694 | 3300009784 | Bacteria | 33749 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02775 | TPP_enzyme_C | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain | 68 | 205 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.