Protein Family IF09321

Metagenome Isolate
309 Members
247 Samples
130 Scaffolds
410.12 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_042237|Ga0466704_042237_14_1357
Length
447 aa
Sequence
MWSVERKVSSEDVLKSAIHEERGQMREKRTFQLPGMTVALVLAGGRGSRLYELTDRRAKPAVYFGGKYRIVDFAMSNCVNSGIRRIGVVTQYKSHSLLRHIQRGWGFLRGEDNEFIDLLPAQQRVDEESWYRGTADAVYQNIDIIETFRPVPKYVLILAGDHVYKMNYAAMLVDHAESGAECTVACIEVPRRDAKGFGVMAVDESDRIVDFVEKPADPPAMPGKPESSLCSMGIYIFNAEYLYNELKRDIDDPTSSHDFGKDIIPQAVRNGVASAHSFDRSCVHAPEEGPNKENYWRDAGTVDAYWEANIDLTATDPALNLYDYNWPVWTYQQQLPPAKFVHNQIDRHGVAIESMVSGGCIISGELNRSLLFSSCRVHSYSRINWSVLLPQVEVGRNARLNRCVIDHGVFIPPGLVIGENPDEDARRFRRTGNGVILVTRQMIERLR

πŸ“Š Sample Types

Isolate 57.9%
Metagenome 42.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 34.6%
Unclassified 22.9%
Termitidae 10.8%
Blattidae 5.2%
Kalotermitidae 5.2%
Armadillidiidae 2.2%
Culicidae 2.2%
Elmidae 2.2%
Ixodidae 1.7%
Drosophilidae 1.7%
Palinuridae 1.3%
Tenebrionidae 1.3%
Rhinotermitidae 1.3%
Termopsidae 1.3%
Argasidae 0.9%
Passalidae 0.9%
Talitridae 0.9%
Berytidae 0.9%
Daphniidae 0.4%
Hodotermitidae 0.4%
Nephropidae 0.4%
Penaeidae 0.4%
Artemiidae 0.4%
Alydidae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 293
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
2 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
3 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
4 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
5 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
6 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
7 2556921669 Shinella sp. DD12 Isolate Daphniidae
8 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
9 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
10 2806310685 Francisella persica ATCC VR-331 Isolate Argasidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
13 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
14 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
15 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
16 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
17 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
18 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
19 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
20 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
21 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
22 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
23 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
28 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 2874209778 Francisella tularensis holarctica FT16C-B1 Isolate Ixodidae
36 2908136803 Vibrio owensii 1700302 Isolate Unclassified
37 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
38 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
39 2506210010 Francisella tularensis tularensis FSC041 Isolate
40 2506210015 Francisella tularensis holarctica FSC185 Isolate
41 2511231129 Vibrio sp. EJY3 Isolate Unclassified
42 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
43 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
44 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
45 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
46 2820115951 Unclassified Proteobacteria Emb289P4bin33 Isolate Unclassified
47 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
48 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
49 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
50 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
51 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
52 637000113 Francisella tularensis tularensis FSC 198 Isolate
53 640963010 Vibrio harveyi HY01 Isolate Unclassified
54 8022345672 Vibrio sp. 070316B Isolate Unclassified
55 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
56 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
57 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
58 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
59 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
60 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
61 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
62 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
63 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
64 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
65 8102102351 Caballeronia sp. INML1 Isolate Coreidae
66 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
67 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
68 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
69 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
70 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
71 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
72 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
73 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
74 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
75 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
76 2871564055 Francisella tularensis holarctica FT9C-G7 Isolate Ixodidae
77 2874203443 Francisella tularensis holarctica FT8C-4F Isolate Ixodidae
78 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
79 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
80 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
81 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
82 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
83 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
84 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
85 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
86 8023757577 Caballeronia peredens LP006 Isolate Coreidae
87 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
88 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
89 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
90 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
91 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
92 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
93 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
94 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
95 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
96 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
97 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
98 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
99 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
100 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
101 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
102 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
103 2820946191 Unclassified Acidobacteria Nt197P3bin31 Isolate Unclassified
104 2864976888 Novosphingobium chloroacetimidivorans S00245 Isolate Elmidae
105 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
106 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
107 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
108 2684622551 Vibrio campbellii E1 Isolate Unclassified
109 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
110 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
111 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
112 8022096067 Vibrio sp. SALL6 Isolate Unclassified
113 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
114 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
115 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
116 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
117 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
118 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
119 8051461712 Vibrio vulnificus Vv002 Isolate
120 8060845732 Vibrio vulnificus Vv006 Isolate
121 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
122 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
123 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
124 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
125 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
126 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
127 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
128 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
129 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
130 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
131 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
132 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
133 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
134 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
135 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
136 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
137 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
138 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
139 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
140 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
141 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
142 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
143 2791355473 Vibrio barjaei 3062 Isolate Unclassified
144 2820418027 Unclassified Firmicutes Lab288P3bin85 Isolate Unclassified
145 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
146 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
147 8051534459 Vibrio vulnificus Vv004 Isolate
148 8069748016 Caballeronia sp. LP003 Isolate Coreidae
149 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
150 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
151 8102109360 Caballeronia sp. INML2 Isolate Coreidae
152 8102145433 Caballeronia sp. LP006 Isolate Coreidae
153 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
154 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
155 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
156 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
157 3006242587 Vibrio sp. RE86 Isolate Unclassified
158 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
159 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
160 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
161 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
162 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
163 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
164 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
165 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
166 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
167 2850895757 Vibrio campbellii 170502 Isolate Unclassified
168 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
169 2871595141 Francisella tularensis 503 Isolate Ixodidae
170 2872471378 Vibrio owensii V180403 Isolate Unclassified
171 2873468275 Agrobacterium vitis S00131 Isolate Elmidae
172 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
173 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
174 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
175 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
176 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
177 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
178 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
179 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
180 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
181 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
182 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
183 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
184 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
185 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
186 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
187 8102117041 Caballeronia sp. INML3 Isolate Coreidae
188 8102131453 Caballeronia sp. INML5 Isolate Coreidae
189 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
190 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
191 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
192 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
193 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
194 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
195 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
196 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
197 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
198 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
199 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
200 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
201 2820947865 Unclassified Acidobacteria Nt197P3bin133 Isolate Unclassified
202 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
203 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
204 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
205 2772190782 Francisella persica ATCC VR-331 Isolate Argasidae
206 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
207 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
208 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
209 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
210 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
211 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
212 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
213 8102124461 Caballeronia sp. INML3B Isolate Coreidae
214 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
215 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
216 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
217 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
218 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
219 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
220 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
221 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
222 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
223 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
224 2864993140 Agrobacterium vitis S00303 Isolate Elmidae
225 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
226 2912570088 Vibrio parahaemolyticus CHN25 Isolate
227 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
228 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
229 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
230 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
231 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
232 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
233 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
234 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
235 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
236 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
237 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
238 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
239 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
240 8051551332 Vibrio vulnificus Vv003 Isolate
241 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
242 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
243 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
244 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
245 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
246 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
247 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10000443 3300010167 Bacteria 51439
2 Ga0160465_101080 3300012803 Bacteria 8768
3 Ga0160466_100063 3300012809 Bacteria 125464
4 Ga0160471_100192 3300012812 Bacteria 22155
5 JGI24698J34947_10059177 3300002449 Bacteria 1895
6 Ga0466710_217703 3300042613 Bacteria 3373
7 Ga0466706_032431 3300042599 Bacteria 50635
8 Ga0466706_200541 3300042599 Bacteria 48383
9 Ga0466706_229988 3300042599 Bacteria 8411
10 Ga0466706_283701 3300042599 Bacteria 11721
11 Ga0466700_421632 3300042600 Bacteria 2556
12 Ga0466707_006107 3300042601 Bacteria 44573
13 Ga0160440_100092 3300012815 Unclassified 101876
14 Ga0160433_100097 3300012846 Bacteria 88061
15 Ga0160448_105441 3300012854 Bacteria 3332
16 Ga0265387_1000025 3300024582 Bacteria 63430
17 Ga0466695_049622 3300042595 Bacteria 26917
18 Ga0466699_101882 3300042597 Bacteria 6010
19 Ga0466699_152342 3300042597 Unclassified 1727
20 Ga0466735_144028 3300042624 Bacteria 1728
21 Ga0466705_383529 3300042612 Bacteria 10943
22 Ga0562374_1417 3300057007 Unclassified 28023
23 Ga0123355_10156936 3300009826 Unclassified 3440
24 Ga0123356_10156848 3300010049 Unclassified 2268
25 Ga0160470_100050 3300012813 Bacteria 172769
26 IMNBL1DRAFT_c0009347 3300000062 Bacteria 4848
27 Ga0068305_10004492 3300005083 Bacteria 39529
28 Ga0072940_1109148 3300005200 Bacteria 6837
29 Ga0466726_278972 3300042619 Bacteria 29992
30 Ga0466706_004763 3300042599 Unclassified 33253
31 Ga0466706_140683 3300042599 Bacteria 7002
32 Ga0466717_290149 3300042604 Unclassified 1786
33 Ga0160470_101171 3300012813 Bacteria 6882
34 Ga0160467_100219 3300012829 Bacteria 73493
35 Ga0160443_100020 3300012848 Bacteria 410950
36 Ga0160430_102382 3300012852 Bacteria 5997
37 Ga0466690_080050 3300042590 Bacteria 2647
38 Ga0466696_010114 3300042596 Bacteria 17230
39 Ga0466699_422540 3300042597 Bacteria 6738
40 Ga0466725_187893 3300042654 Bacteria 24541
41 Ga0123356_10125115 3300010049 Unclassified 2508
42 Ga0160454_100487 3300012798 Bacteria 14283
43 Ga0160471_102359 3300012812 Bacteria 3163
44 Ga0072940_1080275 3300005200 Bacteria 4037
45 Ga0123357_10000734 3300009784 Bacteria 33022
46 Ga0466718_157466 3300042617 Bacteria 5577
47 Ga0466726_024792 3300042619 Bacteria 26336
48 Ga0466729_152338 3300042621 Bacteria 104951
49 Ga0466706_004221 3300042599 Bacteria 8739
50 Ga0466722_055790 3300042609 Bacteria 11661
51 Ga0160447_100927 3300012849 Bacteria 12313
52 Ga0466692_145287 3300042591 Bacteria 39430
53 Ga0466701_015229 3300042598 Bacteria 10106
54 Ga0466703_384890 3300042636 Bacteria 3182
55 Ga0466725_130312 3300042654 Bacteria 15939
56 Ga0123353_10000040 3300010167 Bacteria 139340
57 JGI24700J35501_10930601 3300002508 Bacteria 16421
58 JGI24700J35501_10930603 3300002508 Bacteria 16440
59 Ga0466711_390078 3300042615 Bacteria 32121
60 Ga0466715_409945 3300042616 Unclassified 67330
61 Ga0466706_087956 3300042599 Bacteria 6007
62 Ga0466720_017237 3300042607 Bacteria 16171
63 Ga0160455_100022 3300012837 Bacteria 376035
64 Ga0160472_100173 3300012839 Unclassified 86925
65 Ga0466696_385317 3300042596 Bacteria 6250
66 Ga0466735_078916 3300042624 Bacteria 6122
67 Ga0466705_180755 3300042612 Unclassified 2499
68 Ga0562376_0081 3300056857 Bacteria 226138
69 Ga0123356_10004192 3300010049 Bacteria 14942
70 Ga0123356_10458155 3300010049 Bacteria 1424
71 2227080779 2225789004 Bacteria 173520
72 Ga0123357_10000609 3300009784 Bacteria 35481
73 Ga0466705_436923 3300042612 Bacteria 7832
74 Ga0466712_232413 3300042614 Bacteria 21480
75 Ga0466715_310632 3300042616 Bacteria 3353
76 Ga0466718_147373 3300042617 Bacteria 11031
77 Ga0466726_083459 3300042619 Bacteria 2394
78 Ga0466726_363045 3300042619 Unclassified 6586
79 Ga0466729_168231 3300042621 Bacteria 9378
80 Ga0466706_272622 3300042599 Unclassified 7974
81 Ga0160469_100210 3300012824 Bacteria 50416
82 Ga0160430_108566 3300012852 Bacteria 1921
83 Ga0466691_104899 3300042593 Bacteria 9924
84 Ga0466709_339590 3300042648 Bacteria 5218
85 Ga0466724_25733 3300042649 Bacteria 9630
86 Ga0466697_120553 3300042611 Bacteria 2779
87 Ga0562378_0459 3300056814 Bacteria 69701
88 Ga0123356_10018642 3300010049 Bacteria 6586
89 IMNBL1DRAFT_c0018833 3300000062 Bacteria 2854
90 AustNasuHG_c1008698 3300000089 Bacteria 3593
91 Ga0466710_317641 3300042613 Bacteria 36750
92 Ga0466718_074789 3300042617 Bacteria 15598
93 Ga0466723_070255 3300042618 Bacteria 28764
94 Ga0466726_425806 3300042619 Bacteria 8348
95 Ga0466728_370042 3300042620 Bacteria 4210
96 Ga0466706_059862 3300042599 Bacteria 15934
97 Ga0466706_169919 3300042599 Bacteria 11913
98 Ga0466713_054975 3300042602 Unclassified 3152
99 Ga0466722_008722 3300042609 Bacteria 4421
100 Ga0466657_219053 3300042582 Bacteria 26717
101 Ga0466691_044915 3300042593 Bacteria 21854
102 Ga0466694_372464 3300042594 Bacteria 1319
103 Ga0466734_082283 3300042623 Bacteria 7876
104 Ga0466704_363902 3300042643 Bacteria 140929
105 Ga0466709_283453 3300042648 Bacteria 4003
106 Ga0466724_32630 3300042649 Bacteria 13538
107 Ga0123356_10006381 3300010049 Bacteria 11883
108 Ga0466710_209366 3300042613 Bacteria 5797
109 Ga0466706_074539 3300042599 Bacteria 137679
110 Ga0466657_113751 3300042582 Bacteria 130632
111 Ga0466699_116488 3300042597 Bacteria 2745
112 Ga0466702_198103 3300042635 Bacteria 2774
113 Ga0466704_042237 3300042643 Bacteria 1429
114 Ga0466709_049894 3300042648 Unclassified 53806
115 Ga0466724_31439 3300042649 Bacteria 9380
116 Ga0466727_080583 3300042655 Bacteria 8696
117 Ga0123355_10146644 3300009826 Unclassified 3597
118 Ga0068305_10662626 3300005083 Bacteria 1447
119 Ga0072941_1123023 3300005201 Bacteria 3429
120 Ga0466710_254735 3300042613 Bacteria 2127
121 Ga0466711_273053 3300042615 Bacteria 15842
122 Ga0466723_325720 3300042618 Bacteria 2670
123 Ga0466717_290119 3300042604 Bacteria 2833
124 Ga0466716_183516 3300042605 Bacteria 11086
125 Ga0466722_164655 3300042609 Bacteria 24827
126 Ga0466722_220136 3300042609 Bacteria 5174
127 Ga0160448_100320 3300012854 Bacteria 17927
128 Ga0264413_130089 3300024493 Bacteria 2926
129 Ga0466701_004108 3300042598 Bacteria 13088
130 Ga0466727_157224 3300042655 Bacteria 8350

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00483 NTP_transferase Nucleotidyl transferase 39 313 0.96
PF12804 NTP_transf_3 MobA-like NTP transferase domain 39 186 0.75

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00483 GO:0009058 biosynthetic process BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.