Protein Family IF09317
Metagenome
Isolate
190
Members
49
Samples
184
Scaffolds
293.19
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_035278|Ga0466704_035278_5505_6482
- Length
- 325 aa
- Sequence
- VKQACGKFEFEAGFSDSKDLNPSLPKGECPMVIKKSLGDTVYYTIAYAIIGILTLIVLYPMVYILSASFSTAAMVNAGRVWLFPVKPTLFNYKMVLQYDSVFLGYKNTIIYTVGGTAINVIVTLLCAYPLSRKGFFGRGFFTFLFTFTMIFSGGMIPSYILMRNLHLLNTAWAMMIPGAINVTNMIVTRTYFQNSIPIELLEASKLDGCSDAQYFFRVALPLSASVIAVITLFYAVHHWNAYFSAFLYLSDRNLFPLQLFLRQILVQNQFSGEILTDPEMAEQLQGIAETLKFAIIVLSTAPLMCFYPFAQKHFVRGIMIGSLKG
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.1%
Kalotermitidae
30.4%
Unclassified
13.0%
Rhinotermitidae
8.7%
Termopsidae
4.3%
Hodotermitidae
2.2%
Passalidae
2.2%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 40 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 43 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 44 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 45 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 46 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 49 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_212974 | 3300042612 | Unclassified | 10784 |
| 2 | Ga0466705_249341 | 3300042612 | Unclassified | 2170 |
| 3 | Ga0466733_193953 | 3300042659 | Bacteria | 2940 |
| 4 | Ga0123356_10509570 | 3300010049 | Bacteria | 1360 |
| 5 | Ga0123354_10072358 | 3300010882 | Unclassified | 4965 |
| 6 | Ga0466703_410975 | 3300042636 | Bacteria | 2104 |
| 7 | Ga0466704_092933 | 3300042643 | Bacteria | 16919 |
| 8 | Ga0466708_204486 | 3300042652 | Bacteria | 2484 |
| 9 | Ga0264413_131892 | 3300024493 | Bacteria | 1360 |
| 10 | Ga0466690_092505 | 3300042590 | Bacteria | 3885 |
| 11 | Ga0466715_244267 | 3300042616 | Bacteria | 51711 |
| 12 | Ga0466722_020340 | 3300042609 | Bacteria | 6727 |
| 13 | Ga0466722_057860 | 3300042609 | Bacteria | 5046 |
| 14 | 2227669046 | 2225789004 | Bacteria | 10301 |
| 15 | Ga0466705_033131 | 3300042612 | Unclassified | 4342 |
| 16 | Ga0466705_288220 | 3300042612 | Bacteria | 1574 |
| 17 | Ga0123357_10019651 | 3300009784 | Bacteria | 9009 |
| 18 | Ga0123355_10103223 | 3300009826 | Bacteria | 4482 |
| 19 | Ga0123356_11039718 | 3300010049 | Bacteria | 989 |
| 20 | Ga0123353_10479385 | 3300010167 | Bacteria | 1821 |
| 21 | Ga0123353_10590112 | 3300010167 | Bacteria | 1591 |
| 22 | Ga0466704_111867 | 3300042643 | Bacteria | 3201 |
| 23 | Ga0466704_314825 | 3300042643 | Bacteria | 7124 |
| 24 | Ga0466704_338354 | 3300042643 | Bacteria | 7156 |
| 25 | Ga0466709_404154 | 3300042648 | Bacteria | 6888 |
| 26 | Ga0466696_053715 | 3300042596 | Bacteria | 8941 |
| 27 | Ga0466699_294324 | 3300042597 | Bacteria | 2054 |
| 28 | Ga0466711_114438 | 3300042615 | Bacteria | 3243 |
| 29 | Ga0466715_059099 | 3300042616 | Bacteria | 2817 |
| 30 | Ga0466715_541038 | 3300042616 | Unclassified | 5195 |
| 31 | Ga0466723_069869 | 3300042618 | Bacteria | 1470 |
| 32 | Ga0466726_053108 | 3300042619 | Unclassified | 1130 |
| 33 | Ga0466726_108128 | 3300042619 | Bacteria | 2629 |
| 34 | Ga0466726_287829 | 3300042619 | Bacteria | 2296 |
| 35 | Ga0466728_155469 | 3300042620 | Bacteria | 3220 |
| 36 | Ga0466728_218563 | 3300042620 | Bacteria | 3060 |
| 37 | Ga0466706_225623 | 3300042599 | Bacteria | 54796 |
| 38 | Ga0466707_029535 | 3300042601 | Bacteria | 5478 |
| 39 | Ga0466716_001762 | 3300042605 | Bacteria | 1270 |
| 40 | Ga0466719_291785 | 3300042606 | Bacteria | 2050 |
| 41 | Ga0466719_350126 | 3300042606 | Bacteria | 1279 |
| 42 | Ga0466720_152408 | 3300042607 | Bacteria | 2175 |
| 43 | Ga0466705_068854 | 3300042612 | Bacteria | 3990 |
| 44 | Ga0466705_089311 | 3300042612 | Bacteria | 7183 |
| 45 | Ga0123356_10304280 | 3300010049 | Bacteria | 1701 |
| 46 | Ga0160466_100142 | 3300012809 | Bacteria | 57948 |
| 47 | Ga0466703_152379 | 3300042636 | Bacteria | 3510 |
| 48 | Ga0466727_169190 | 3300042655 | Bacteria | 1306 |
| 49 | Ga0456237_0000399 | 3300041968 | Bacteria | 6532 |
| 50 | Ga0466696_069438 | 3300042596 | Bacteria | 4816 |
| 51 | Ga0466696_191612 | 3300042596 | Bacteria | 12775 |
| 52 | Ga0466696_270319 | 3300042596 | Bacteria | 5083 |
| 53 | Ga0466705_528793 | 3300042612 | Unclassified | 1738 |
| 54 | Ga0466711_116080 | 3300042615 | Bacteria | 1859 |
| 55 | Ga0466715_267293 | 3300042616 | Unclassified | 1368 |
| 56 | Ga0466728_157095 | 3300042620 | Bacteria | 1338 |
| 57 | Ga0466719_295886 | 3300042606 | Bacteria | 3276 |
| 58 | Ga0466719_378553 | 3300042606 | Bacteria | 1412 |
| 59 | Ga0466719_407777 | 3300042606 | Bacteria | 3171 |
| 60 | Ga0466722_043403 | 3300042609 | Bacteria | 4084 |
| 61 | Ga0466722_049025 | 3300042609 | Bacteria | 5508 |
| 62 | JGI24698J34947_10050991 | 3300002449 | Bacteria | 2084 |
| 63 | Ga0123355_10017764 | 3300009826 | Bacteria | 11249 |
| 64 | Ga0123356_10190316 | 3300010049 | Unclassified | 2082 |
| 65 | Ga0123356_10211047 | 3300010049 | Bacteria | 1990 |
| 66 | Ga0123353_10255922 | 3300010167 | Bacteria | 2708 |
| 67 | Ga0123353_10810663 | 3300010167 | Bacteria | 1291 |
| 68 | Ga0123354_10012842 | 3300010882 | Bacteria | 12973 |
| 69 | Ga0123354_10249975 | 3300010882 | Bacteria | 1799 |
| 70 | Ga0160464_100749 | 3300012805 | Bacteria | 18465 |
| 71 | Ga0466703_307420 | 3300042636 | Bacteria | 2322 |
| 72 | Ga0466703_427125 | 3300042636 | Bacteria | 22449 |
| 73 | Ga0466709_141628 | 3300042648 | Bacteria | 21341 |
| 74 | Ga0466708_030908 | 3300042652 | Bacteria | 3837 |
| 75 | Ga0466708_312620 | 3300042652 | Bacteria | 3711 |
| 76 | Ga0466727_058298 | 3300042655 | Bacteria | 1904 |
| 77 | Ga0466656_266991 | 3300042550 | Bacteria | 1156 |
| 78 | Ga0466692_065774 | 3300042591 | Bacteria | 22718 |
| 79 | Ga0466692_070854 | 3300042591 | Bacteria | 20045 |
| 80 | Ga0466691_010182 | 3300042593 | Bacteria | 10973 |
| 81 | Ga0466694_012329 | 3300042594 | Bacteria | 6428 |
| 82 | Ga0466696_063857 | 3300042596 | Unclassified | 13318 |
| 83 | Ga0466696_087170 | 3300042596 | Bacteria | 2103 |
| 84 | Ga0466696_121115 | 3300042596 | Bacteria | 6805 |
| 85 | Ga0466696_468179 | 3300042596 | Bacteria | 5864 |
| 86 | Ga0466705_467809 | 3300042612 | Bacteria | 3908 |
| 87 | Ga0466705_528951 | 3300042612 | Unclassified | 3625 |
| 88 | Ga0466715_002340 | 3300042616 | Bacteria | 37524 |
| 89 | Ga0466715_009713 | 3300042616 | Bacteria | 10584 |
| 90 | Ga0466715_032155 | 3300042616 | Bacteria | 207155 |
| 91 | Ga0466715_143616 | 3300042616 | Bacteria | 37202 |
| 92 | Ga0466715_181701 | 3300042616 | Bacteria | 4513 |
| 93 | Ga0466728_398855 | 3300042620 | Bacteria | 2615 |
| 94 | Ga0466706_218483 | 3300042599 | Bacteria | 2032 |
| 95 | Ga0466719_294638 | 3300042606 | Bacteria | 3377 |
| 96 | Ga0466722_054246 | 3300042609 | Bacteria | 16374 |
| 97 | JGI24702J35022_10005947 | 3300002462 | Bacteria | 7090 |
| 98 | Ga0072940_1178405 | 3300005200 | Bacteria | 2572 |
| 99 | Ga0466705_038946 | 3300042612 | Bacteria | 3483 |
| 100 | Ga0466705_165672 | 3300042612 | Bacteria | 8553 |
| 101 | Ga0466703_323226 | 3300042636 | Bacteria | 2460 |
| 102 | Ga0466709_110252 | 3300042648 | Bacteria | 21503 |
| 103 | Ga0466709_250076 | 3300042648 | Bacteria | 8143 |
| 104 | Ga0466708_159926 | 3300042652 | Bacteria | 2722 |
| 105 | Ga0466727_115388 | 3300042655 | Bacteria | 4546 |
| 106 | Ga0466727_231456 | 3300042655 | Bacteria | 1852 |
| 107 | Ga0466727_279047 | 3300042655 | Bacteria | 2668 |
| 108 | Ga0264413_120615 | 3300024493 | Bacteria | 4282 |
| 109 | Ga0466691_100448 | 3300042593 | Bacteria | 1213 |
| 110 | Ga0466705_512838 | 3300042612 | Bacteria | 1340 |
| 111 | Ga0466711_028301 | 3300042615 | Bacteria | 1763 |
| 112 | Ga0466715_261498 | 3300042616 | Bacteria | 6110 |
| 113 | Ga0466723_170390 | 3300042618 | Bacteria | 3858 |
| 114 | Ga0466729_082901 | 3300042621 | Bacteria | 1768 |
| 115 | Ga0466707_232373 | 3300042601 | Bacteria | 1905 |
| 116 | Ga0466722_033433 | 3300042609 | Bacteria | 9902 |
| 117 | JGI24698J34947_10001856 | 3300002449 | Unclassified | 11275 |
| 118 | Ga0123353_10305540 | 3300010167 | Bacteria | 2425 |
| 119 | Ga0466703_342478 | 3300042636 | Bacteria | 2508 |
| 120 | Ga0466703_411264 | 3300042636 | Bacteria | 5159 |
| 121 | Ga0466704_040365 | 3300042643 | Unclassified | 18984 |
| 122 | Ga0466704_096658 | 3300042643 | Unclassified | 3189 |
| 123 | Ga0466708_055817 | 3300042652 | Bacteria | 21261 |
| 124 | Ga0466708_413642 | 3300042652 | Bacteria | 5669 |
| 125 | Ga0466727_263349 | 3300042655 | Bacteria | 1955 |
| 126 | Ga0264413_144336 | 3300024493 | Bacteria | 2990 |
| 127 | Ga0466690_381303 | 3300042590 | Bacteria | 2139 |
| 128 | Ga0466692_091480 | 3300042591 | Bacteria | 3627 |
| 129 | Ga0466696_038427 | 3300042596 | Bacteria | 10463 |
| 130 | Ga0466696_128839 | 3300042596 | Bacteria | 6864 |
| 131 | Ga0466699_389557 | 3300042597 | Bacteria | 1090 |
| 132 | Ga0466711_189234 | 3300042615 | Bacteria | 7321 |
| 133 | Ga0466715_056308 | 3300042616 | Bacteria | 7015 |
| 134 | Ga0466715_188352 | 3300042616 | Bacteria | 7345 |
| 135 | Ga0466723_140797 | 3300042618 | Bacteria | 4132 |
| 136 | Ga0466726_161402 | 3300042619 | Bacteria | 4228 |
| 137 | Ga0466728_200089 | 3300042620 | Bacteria | 1517 |
| 138 | Ga0466729_045272 | 3300042621 | Bacteria | 1179 |
| 139 | Ga0466729_155783 | 3300042621 | Bacteria | 2316 |
| 140 | Ga0466714_113050 | 3300042603 | Bacteria | 3737 |
| 141 | Ga0466722_073491 | 3300042609 | Bacteria | 4872 |
| 142 | JGI24698J34947_10076377 | 3300002449 | Bacteria | 1588 |
| 143 | Ga0466705_202616 | 3300042612 | Bacteria | 7357 |
| 144 | Ga0466705_328094 | 3300042612 | Bacteria | 2961 |
| 145 | Ga0123356_10267123 | 3300010049 | Bacteria | 1798 |
| 146 | Ga0123353_10000095 | 3300010167 | Bacteria | 101562 |
| 147 | Ga0466704_035278 | 3300042643 | Bacteria | 6764 |
| 148 | Ga0466704_235007 | 3300042643 | Bacteria | 5768 |
| 149 | Ga0466704_579691 | 3300042643 | Bacteria | 9082 |
| 150 | Ga0466727_300030 | 3300042655 | Bacteria | 6358 |
| 151 | Ga0466692_156294 | 3300042591 | Bacteria | 10715 |
| 152 | Ga0466715_019746 | 3300042616 | Bacteria | 10823 |
| 153 | Ga0466715_124051 | 3300042616 | Bacteria | 3623 |
| 154 | Ga0466715_458888 | 3300042616 | Bacteria | 1314 |
| 155 | Ga0466723_159075 | 3300042618 | Unclassified | 8154 |
| 156 | Ga0466728_160182 | 3300042620 | Unclassified | 1154 |
| 157 | Ga0466728_170548 | 3300042620 | Bacteria | 7504 |
| 158 | Ga0466728_373553 | 3300042620 | Bacteria | 5044 |
| 159 | Ga0466729_131355 | 3300042621 | Bacteria | 2407 |
| 160 | Ga0466706_115878 | 3300042599 | Bacteria | 2235 |
| 161 | Ga0466707_150646 | 3300042601 | Bacteria | 2479 |
| 162 | Ga0466719_067597 | 3300042606 | Bacteria | 2181 |
| 163 | Ga0466732_021931 | 3300042656 | Bacteria | 3094 |
| 164 | Ga0123355_10008000 | 3300009826 | Bacteria | 15940 |
| 165 | Ga0123356_10242909 | 3300010049 | Bacteria | 1873 |
| 166 | Ga0123353_10330711 | 3300010167 | Bacteria | 2307 |
| 167 | Ga0123353_10738590 | 3300010167 | Bacteria | 1372 |
| 168 | Ga0466703_325953 | 3300042636 | Bacteria | 3092 |
| 169 | Ga0466709_293637 | 3300042648 | Bacteria | 12811 |
| 170 | Ga0466708_357003 | 3300042652 | Bacteria | 5892 |
| 171 | Ga0466708_467365 | 3300042652 | Bacteria | 8824 |
| 172 | Ga0466725_431986 | 3300042654 | Bacteria | 1955 |
| 173 | Ga0466692_077320 | 3300042591 | Bacteria | 3619 |
| 174 | Ga0466694_109991 | 3300042594 | Bacteria | 8877 |
| 175 | Ga0466705_399699 | 3300042612 | Bacteria | 12154 |
| 176 | Ga0466712_024948 | 3300042614 | Bacteria | 23138 |
| 177 | Ga0466711_065207 | 3300042615 | Bacteria | 5009 |
| 178 | Ga0466718_155618 | 3300042617 | Bacteria | 4274 |
| 179 | Ga0466723_142966 | 3300042618 | Bacteria | 2620 |
| 180 | Ga0466726_365576 | 3300042619 | Bacteria | 9892 |
| 181 | Ga0466728_402312 | 3300042620 | Bacteria | 4355 |
| 182 | Ga0466707_034086 | 3300042601 | Bacteria | 1940 |
| 183 | Ga0466719_377238 | 3300042606 | Bacteria | 2056 |
| 184 | Ga0123357_10000397 | 3300009784 | Bacteria | 41367 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 121 | 318 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.