Protein Family IF09286
Metagenome
Isolate
137
Members
70
Samples
120
Scaffolds
306.78
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_373673|Ga0466703_373673_4573_5580
- Length
- 335 aa
- Sequence
- MRLFFIRSLFGLKIFMYLCTQNKKMNNEQIDINQFRPLGNIEIIAKQLVEGFITGLHKSPFHGFSVEFAEYRPYNTGESTRNIDWKLYGRTDKLFVKQYEEETNLRCQVIMDTSSSMYFPQRQKLSLEHPNKIYFSVYAAAAIMQIMKQQRDAIGLSLFSDSVYFHSQAKSSAIHLKSLYHELEHLLIPIPINEQHGTNVTNSLHEVAERIHRRSLVVIFSDVFDNSKQEDLFLALQHLKHNKHDVILFHVYDKSLEIDFDFDNKPYKFIDVESGNTLKVNASEIKTHYRKAIKAFKDELKVRCGQYQVDLVETDINQGFHHVMLTYLLKRQRLF
Sample Types
Isolate
12.4%
Metagenome
87.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.3%
Unclassified
20.9%
Kalotermitidae
17.9%
Passalidae
3.0%
Formicidae
3.0%
Rhinotermitidae
3.0%
Armadillidiidae
3.0%
Termopsidae
3.0%
Hodotermitidae
1.5%
Daphniidae
1.5%
Elmidae
1.5%
Apidae
1.5%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 2 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 13 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 18 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 19 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 32 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 33 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 37 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 38 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 39 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 40 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 2820786992 | Unclassified Bacteroidetes Emb289P1bin66 | Isolate | Unclassified |
| 47 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 52 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 59 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 61 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 62 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 63 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 64 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_010542 | 3300038395 | Bacteria | 2603 |
| 2 | Ga0466657_024645 | 3300042582 | Bacteria | 3482 |
| 3 | Ga0466690_368796 | 3300042590 | Unclassified | 2158 |
| 4 | Ga0466694_040622 | 3300042594 | Bacteria | 1276 |
| 5 | Ga0466707_420205 | 3300042601 | Bacteria | 47782 |
| 6 | Ga0466714_071310 | 3300042603 | Bacteria | 4542 |
| 7 | Ga0123355_10315451 | 3300009826 | Bacteria | 2113 |
| 8 | Ga0123356_10000164 | 3300010049 | Bacteria | 74678 |
| 9 | Ga0123353_10644599 | 3300010167 | Unclassified | 1501 |
| 10 | Ga0123354_10362259 | 3300010882 | Bacteria | 1277 |
| 11 | Ga0160465_100037 | 3300012803 | Bacteria | 178841 |
| 12 | IMNBL1DRAFT_c0007731 | 3300000062 | Bacteria | 5593 |
| 13 | JGI24702J35022_10012707 | 3300002462 | Bacteria | 4674 |
| 14 | Ga0068305_10647953 | 3300005083 | Bacteria | 5498 |
| 15 | Ga0466715_628336 | 3300042616 | Bacteria | 2778 |
| 16 | Ga0466731_105324 | 3300042622 | Bacteria | 1097 |
| 17 | Ga0466735_200330 | 3300042624 | Bacteria | 28469 |
| 18 | Ga0466708_175044 | 3300042652 | Unclassified | 15570 |
| 19 | Ga0160433_100059 | 3300012846 | Bacteria | 121476 |
| 20 | Ga0466694_189182 | 3300042594 | Bacteria | 3864 |
| 21 | Ga0466694_198766 | 3300042594 | Unclassified | 1129 |
| 22 | Ga0466694_272505 | 3300042594 | Bacteria | 4620 |
| 23 | Ga0466695_313410 | 3300042595 | Bacteria | 2191 |
| 24 | Ga0466701_014088 | 3300042598 | Bacteria | 4688 |
| 25 | Ga0466701_100426 | 3300042598 | Bacteria | 4734 |
| 26 | Ga0466706_043649 | 3300042599 | Bacteria | 38829 |
| 27 | Ga0466713_098049 | 3300042602 | Bacteria | 14184 |
| 28 | Ga0123356_10624370 | 3300010049 | Bacteria | 1244 |
| 29 | Ga0123353_10000067 | 3300010167 | Bacteria | 114305 |
| 30 | Ga0123353_10002765 | 3300010167 | Bacteria | 21906 |
| 31 | Ga0123353_10021165 | 3300010167 | Bacteria | 9750 |
| 32 | Ga0123353_10056610 | 3300010167 | Bacteria | 6276 |
| 33 | Ga0123353_10170379 | 3300010167 | Bacteria | 3457 |
| 34 | Ga0123353_10424779 | 3300010167 | Bacteria | 1968 |
| 35 | IMNBL1DRAFT_c0036023 | 3300000062 | Bacteria | 1735 |
| 36 | JGI24702J35022_10034360 | 3300002462 | Bacteria | 2711 |
| 37 | JGI24696J40584_12958447 | 3300002834 | Unclassified | 4150 |
| 38 | Ga0072941_1109834 | 3300005201 | Bacteria | 4512 |
| 39 | Ga0123357_10000098 | 3300009784 | Bacteria | 71462 |
| 40 | Ga0466723_071083 | 3300042618 | Bacteria | 3725 |
| 41 | Ga0466726_377792 | 3300042619 | Bacteria | 6510 |
| 42 | Ga0466697_173942 | 3300042611 | Bacteria | 1559 |
| 43 | Ga0466729_252861 | 3300042621 | Bacteria | 9360 |
| 44 | Ga0466735_036073 | 3300042624 | Bacteria | 2407 |
| 45 | Ga0466704_078687 | 3300042643 | Unclassified | 2528 |
| 46 | Ga0466656_313302 | 3300042550 | Bacteria | 2583 |
| 47 | Ga0466696_203255 | 3300042596 | Bacteria | 7801 |
| 48 | Ga0466696_407626 | 3300042596 | Bacteria | 1230 |
| 49 | Ga0466706_058902 | 3300042599 | Bacteria | 65436 |
| 50 | Ga0466713_076070 | 3300042602 | Bacteria | 23767 |
| 51 | Ga0466717_251260 | 3300042604 | Bacteria | 2524 |
| 52 | Ga0466722_135473 | 3300042609 | Bacteria | 2963 |
| 53 | Ga0466698_267174 | 3300042610 | Bacteria | 1105 |
| 54 | Ga0123355_10000308 | 3300009826 | Bacteria | 62784 |
| 55 | Ga0123353_10580715 | 3300010167 | Bacteria | 1608 |
| 56 | Ga0466710_130006 | 3300042613 | Bacteria | 3298 |
| 57 | Ga0466711_283396 | 3300042615 | Bacteria | 10741 |
| 58 | Ga0466705_101462 | 3300042612 | Bacteria | 9396 |
| 59 | Ga0466703_373673 | 3300042636 | Bacteria | 6950 |
| 60 | Ga0466709_314545 | 3300042648 | Bacteria | 211401 |
| 61 | Ga0466733_163001 | 3300042659 | Bacteria | 4927 |
| 62 | Ga0466657_300253 | 3300042582 | Bacteria | 17191 |
| 63 | Ga0466691_009650 | 3300042593 | Bacteria | 16342 |
| 64 | Ga0466695_398450 | 3300042595 | Bacteria | 8670 |
| 65 | Ga0466696_325226 | 3300042596 | Bacteria | 8602 |
| 66 | Ga0466699_230827 | 3300042597 | Bacteria | 1019 |
| 67 | Ga0123355_10000074 | 3300009826 | Bacteria | 105380 |
| 68 | Ga0123353_10000321 | 3300010167 | Bacteria | 59258 |
| 69 | Ga0123353_10338725 | 3300010167 | Bacteria | 2273 |
| 70 | JGI24695J34938_10047181 | 3300002450 | Bacteria | 1903 |
| 71 | JGI24696J40584_12961690 | 3300002834 | Unclassified | 37521 |
| 72 | Ga0466710_081066 | 3300042613 | Bacteria | 1727 |
| 73 | Ga0466704_515351 | 3300042643 | Bacteria | 2113 |
| 74 | Ga0415639_007438 | 3300038395 | Unclassified | 4119 |
| 75 | Ga0466656_088036 | 3300042550 | Bacteria | 15550 |
| 76 | Ga0466657_240938 | 3300042582 | Bacteria | 4051 |
| 77 | Ga0466693_311496 | 3300042592 | Bacteria | 1417 |
| 78 | Ga0466696_344568 | 3300042596 | Unclassified | 3562 |
| 79 | Ga0466700_419182 | 3300042600 | Bacteria | 3506 |
| 80 | Ga0466714_010844 | 3300042603 | Bacteria | 29148 |
| 81 | Ga0123353_10009223 | 3300010167 | Bacteria | 13581 |
| 82 | Ga0123353_10110088 | 3300010167 | Bacteria | 4438 |
| 83 | Ga0123354_10001519 | 3300010882 | Bacteria | 28402 |
| 84 | Ga0466733_065509 | 3300042659 | Bacteria | 7512 |
| 85 | Ga0466693_366921 | 3300042592 | Bacteria | 3318 |
| 86 | Ga0466691_013866 | 3300042593 | Bacteria | 4153 |
| 87 | Ga0466695_067706 | 3300042595 | Bacteria | 1228 |
| 88 | Ga0466696_378508 | 3300042596 | Bacteria | 10746 |
| 89 | Ga0466699_189306 | 3300042597 | Bacteria | 1772 |
| 90 | Ga0466706_143471 | 3300042599 | Bacteria | 19207 |
| 91 | Ga0466713_105299 | 3300042602 | Bacteria | 19535 |
| 92 | Ga0123355_10158466 | 3300009826 | Bacteria | 3417 |
| 93 | Ga0123355_10438499 | 3300009826 | Bacteria | 1655 |
| 94 | Ga0123353_10534042 | 3300010167 | Bacteria | 1697 |
| 95 | Ga0123354_10292605 | 3300010882 | Unclassified | 1557 |
| 96 | JGI24705J35276_12181310 | 3300002504 | Bacteria | 1371 |
| 97 | JGI24696J40584_12960630 | 3300002834 | Unclassified | 7839 |
| 98 | Ga0072940_1486056 | 3300005200 | Bacteria | 1350 |
| 99 | Ga0103267_1000039 | 3300007190 | Bacteria | 55786 |
| 100 | Ga0103268_1001855 | 3300007192 | Bacteria | 4923 |
| 101 | Ga0466709_324730 | 3300042648 | Bacteria | 12059 |
| 102 | Ga0466732_043598 | 3300042656 | Bacteria | 56649 |
| 103 | Ga0466699_366066 | 3300042597 | Bacteria | 1846 |
| 104 | Ga0466706_014102 | 3300042599 | Bacteria | 29927 |
| 105 | Ga0466713_057198 | 3300042602 | Bacteria | 57543 |
| 106 | Ga0466719_559118 | 3300042606 | Bacteria | 12880 |
| 107 | Ga0123353_10000161 | 3300010167 | Bacteria | 85161 |
| 108 | Ga0123353_10001361 | 3300010167 | Bacteria | 29989 |
| 109 | Ga0123353_10001374 | 3300010167 | Bacteria | 29814 |
| 110 | Ga0123353_10336080 | 3300010167 | Bacteria | 2284 |
| 111 | IMNBGM34_c000995 | 3300000036 | Bacteria | 5883 |
| 112 | Ga0072940_1196387 | 3300005200 | Bacteria | 1549 |
| 113 | Ga0103267_1000104 | 3300007190 | Bacteria | 52998 |
| 114 | Ga0160455_100182 | 3300012837 | Bacteria | 62069 |
| 115 | Ga0123356_10371216 | 3300010049 | Bacteria | 1561 |
| 116 | JGI24695J34938_10031702 | 3300002450 | Bacteria | 2448 |
| 117 | JGI24696J40584_12950836 | 3300002834 | Bacteria | 2185 |
| 118 | Ga0103267_1000280 | 3300007190 | Bacteria | 18463 |
| 119 | Ga0466711_167904 | 3300042615 | Bacteria | 18151 |
| 120 | Ga0466703_089159 | 3300042636 | Bacteria | 5119 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.