Protein Family IF09246
Metagenome
Metatranscriptome
Isolate
297
Members
98
Samples
260
Scaffolds
329.21
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_302657|Ga0466703_302657_6687_7793
- Length
- 368 aa
- Sequence
- MFEHCPSLRWHINNTNFFIVIPLLICYNDSVKFLSGGKPVKQENKYGREKLLDIYRVMRQIRLFEETAFRFFQENKLRGSVHLCIGQEAVSGAVIGLLDDGDYITSTHRGHGHGIAKSRDLKSAFSELMGKEAGFCHGRGGSMHICDLAKGNLGANAIVGGGLPIAVGGALAQKLRKQKHVTVAFFGDGASNQGTFHESLNLASVWKLPVVFVCENNGFGISVPVKQSTSVKDIAVRSTGYDMPGFVVDGNDVMAILDVFAKCKERALAGEGPSLIEAKTYRWKGHWTGDPEVYRTREEVEAWMEKCPLKRFRAYLLENGVAPEKELAEIDSKAQADVDEAAQFALLAPEPDPATVMDGMYVEGAYPL
Sample Types
Isolate
12.5%
Metagenome
87.2%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
26.7%
Kalotermitidae
15.6%
Unclassified
14.4%
Tenebrionidae
5.6%
Formicidae
4.4%
Rhinotermitidae
4.4%
Scarabaeidae
4.4%
Drosophilidae
3.3%
Termopsidae
3.3%
Passalidae
2.2%
Coreidae
2.2%
Culicidae
2.2%
Calliphoridae
1.1%
Hydrophilidae
1.1%
Vespidae
1.1%
Hodotermitidae
1.1%
Elmidae
1.1%
Libellulidae
1.1%
Largidae
1.1%
Muscidae
1.1%
Gomphidae
1.1%
Curculionidae
1.1%
Taxonomy
Archaea
1
Bacteria
265
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 2 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 3 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 4 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 5 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 6 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 7 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 8 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 16 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 17 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 18 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 27 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 30 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 31 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 32 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 33 | 2820719201 | Unclassified Fibrobacteres Lab288P3bin119 | Isolate | Unclassified |
| 34 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 35 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 41 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 42 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 43 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 44 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 45 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 46 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 53 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 54 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 55 | 2820176377 | Unclassified Planctomycetes Th196P3bin111 | Isolate | Unclassified |
| 56 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 57 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 58 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 59 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 60 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 61 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 62 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 63 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 64 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 65 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 66 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 67 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 70 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 71 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 74 | 3300005313 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut | Metagenome | Drosophilidae |
| 75 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 76 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 77 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 78 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 79 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 80 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 81 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 82 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 83 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 84 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 85 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 86 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 87 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 88 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 89 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 90 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 91 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 92 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 93 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 94 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 95 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 96 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 97 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 98 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10180820 | 3300009784 | Bacteria | 2463 |
| 2 | Ga0123355_10159297 | 3300009826 | Bacteria | 3405 |
| 3 | Ga0123356_10001008 | 3300010049 | Bacteria | 31271 |
| 4 | Ga0123356_10381356 | 3300010049 | Bacteria | 1542 |
| 5 | Ga0123354_10282460 | 3300010882 | Bacteria | 1609 |
| 6 | Ga0562374_0659 | 3300057007 | Bacteria | 52209 |
| 7 | CVPL010W_10008275 | 3300002931 | Bacteria | 9901 |
| 8 | Ga0123357_10000965 | 3300009784 | Bacteria | 29254 |
| 9 | Ga0466703_409083 | 3300042636 | Bacteria | 4493 |
| 10 | Ga0466704_427325 | 3300042643 | Unclassified | 2061 |
| 11 | Ga0466709_305195 | 3300042648 | Bacteria | 19140 |
| 12 | Ga0466709_315890 | 3300042648 | Bacteria | 8391 |
| 13 | Ga0466711_025238 | 3300042615 | Bacteria | 16446 |
| 14 | Ga0466711_157815 | 3300042615 | Bacteria | 7811 |
| 15 | Ga0466715_331494 | 3300042616 | Bacteria | 1228 |
| 16 | Ga0466718_095164 | 3300042617 | Bacteria | 2387 |
| 17 | Ga0466723_082453 | 3300042618 | Bacteria | 72592 |
| 18 | Ga0466723_116956 | 3300042618 | Bacteria | 36910 |
| 19 | Ga0466723_248397 | 3300042618 | Bacteria | 5144 |
| 20 | Ga0466726_119090 | 3300042619 | Bacteria | 3269 |
| 21 | Ga0466728_449310 | 3300042620 | Bacteria | 6053 |
| 22 | Ga0160459_100048 | 3300012831 | Bacteria | 189455 |
| 23 | Ga0466690_199920 | 3300042590 | Bacteria | 33657 |
| 24 | Ga0466690_386226 | 3300042590 | Bacteria | 2663 |
| 25 | Ga0466691_082234 | 3300042593 | Bacteria | 12707 |
| 26 | Ga0466696_030909 | 3300042596 | Unclassified | 20851 |
| 27 | Ga0466696_084406 | 3300042596 | Bacteria | 6342 |
| 28 | Ga0466717_296953 | 3300042604 | Bacteria | 8467 |
| 29 | Ga0466716_031282 | 3300042605 | Bacteria | 22880 |
| 30 | Ga0466719_032541 | 3300042606 | Unclassified | 1639 |
| 31 | Ga0466719_117650 | 3300042606 | Bacteria | 4291 |
| 32 | Ga0466722_064703 | 3300042609 | Bacteria | 3301 |
| 33 | Ga0466722_144635 | 3300042609 | Bacteria | 3433 |
| 34 | Ga0123357_10021157 | 3300009784 | Bacteria | 8705 |
| 35 | Ga0123355_10036880 | 3300009826 | Bacteria | 7950 |
| 36 | Ga0123356_10000395 | 3300010049 | Bacteria | 49807 |
| 37 | Ga0123353_10090437 | 3300010167 | Bacteria | 4929 |
| 38 | Ga0123354_10195033 | 3300010882 | Bacteria | 2251 |
| 39 | Ga0123354_10317464 | 3300010882 | Bacteria | 1444 |
| 40 | Ga0123354_10337085 | 3300010882 | Bacteria | 1365 |
| 41 | Ga0074307_1001163 | 3300005313 | Bacteria | 2961 |
| 42 | Ga0466705_237158 | 3300042612 | Bacteria | 1164 |
| 43 | Ga0466705_349708 | 3300042612 | Bacteria | 12181 |
| 44 | Ga0466705_352585 | 3300042612 | Bacteria | 4066 |
| 45 | Ga0466703_302657 | 3300042636 | Bacteria | 56159 |
| 46 | Ga0466704_074758 | 3300042643 | Bacteria | 18855 |
| 47 | Ga0466704_088412 | 3300042643 | Bacteria | 12362 |
| 48 | Ga0466704_222871 | 3300042643 | Bacteria | 12150 |
| 49 | Ga0466704_357701 | 3300042643 | Bacteria | 2561 |
| 50 | Ga0466709_255069 | 3300042648 | Bacteria | 1554 |
| 51 | Ga0466724_22252 | 3300042649 | Bacteria | 197662 |
| 52 | Ga0466727_048980 | 3300042655 | Bacteria | 2040 |
| 53 | Ga0466727_289144 | 3300042655 | Bacteria | 2193 |
| 54 | Ga0466711_101207 | 3300042615 | Bacteria | 8662 |
| 55 | Ga0466711_255053 | 3300042615 | Bacteria | 4189 |
| 56 | Ga0466715_116485 | 3300042616 | Bacteria | 18352 |
| 57 | Ga0466715_146030 | 3300042616 | Bacteria | 18663 |
| 58 | Ga0466715_329530 | 3300042616 | Bacteria | 1524 |
| 59 | Ga0466728_474671 | 3300042620 | Bacteria | 48953 |
| 60 | Ga0466692_181666 | 3300042591 | Bacteria | 2046 |
| 61 | Ga0466691_153909 | 3300042593 | Bacteria | 6840 |
| 62 | Ga0466707_142172 | 3300042601 | Bacteria | 9812 |
| 63 | Ga0466707_232466 | 3300042601 | Bacteria | 1712 |
| 64 | Ga0466707_356443 | 3300042601 | Bacteria | 1666 |
| 65 | Ga0466713_006243 | 3300042602 | Bacteria | 73153 |
| 66 | Ga0466713_130503 | 3300042602 | Bacteria | 31469 |
| 67 | Ga0466719_076681 | 3300042606 | Bacteria | 3046 |
| 68 | Ga0123355_10064553 | 3300009826 | Bacteria | 5899 |
| 69 | Ga0123356_10225804 | 3300010049 | Unclassified | 1933 |
| 70 | Ga0123353_10073523 | 3300010167 | Bacteria | 5495 |
| 71 | Ga0466733_066830 | 3300042659 | Bacteria | 3214 |
| 72 | Ga0562374_0047 | 3300057007 | Bacteria | 547684 |
| 73 | Ga0466735_137132 | 3300042624 | Bacteria | 2613 |
| 74 | Ga0466704_051227 | 3300042643 | Bacteria | 5251 |
| 75 | Ga0466704_378756 | 3300042643 | Unclassified | 9782 |
| 76 | Ga0466708_432123 | 3300042652 | Unclassified | 5861 |
| 77 | Ga0466727_311369 | 3300042655 | Bacteria | 1923 |
| 78 | Ga0466705_488913 | 3300042612 | Bacteria | 7342 |
| 79 | Ga0466705_493588 | 3300042612 | Unclassified | 2558 |
| 80 | Ga0466715_022139 | 3300042616 | Bacteria | 16991 |
| 81 | Ga0466715_186552 | 3300042616 | Bacteria | 8082 |
| 82 | Ga0466715_401011 | 3300042616 | Bacteria | 15874 |
| 83 | Ga0466715_518734 | 3300042616 | Bacteria | 17293 |
| 84 | Ga0466723_151180 | 3300042618 | Bacteria | 44562 |
| 85 | Ga0466726_390903 | 3300042619 | Bacteria | 8651 |
| 86 | Ga0466728_071973 | 3300042620 | Bacteria | 4359 |
| 87 | Ga0466692_119721 | 3300042591 | Bacteria | 2672 |
| 88 | Ga0466693_319707 | 3300042592 | Bacteria | 4547 |
| 89 | Ga0466691_082016 | 3300042593 | Bacteria | 10945 |
| 90 | Ga0466706_250391 | 3300042599 | Bacteria | 2461 |
| 91 | Ga0466700_054460 | 3300042600 | Bacteria | 102434 |
| 92 | Ga0466700_097738 | 3300042600 | Unclassified | 2168 |
| 93 | Ga0466707_073420 | 3300042601 | Bacteria | 34296 |
| 94 | Ga0466707_309932 | 3300042601 | Bacteria | 2748 |
| 95 | Ga0466713_152269 | 3300042602 | Bacteria | 4661 |
| 96 | Ga0466722_056419 | 3300042609 | Bacteria | 18166 |
| 97 | Ga0466722_172433 | 3300042609 | Bacteria | 6784 |
| 98 | Ga0466722_196023 | 3300042609 | Bacteria | 16789 |
| 99 | Ga0123356_10095319 | 3300010049 | Bacteria | 2844 |
| 100 | Ga0123353_10109346 | 3300010167 | Bacteria | 4454 |
| 101 | Ga0123353_10135554 | 3300010167 | Bacteria | 3948 |
| 102 | Ga0123353_10507113 | 3300010167 | Bacteria | 1755 |
| 103 | Ga0123354_10230758 | 3300010882 | Bacteria | 1936 |
| 104 | JGI24702J35022_10000772 | 3300002462 | Bacteria | 19865 |
| 105 | Ga0104040_1142188 | 3300007149 | Unclassified | 3372 |
| 106 | Ga0466703_118587 | 3300042636 | Bacteria | 9325 |
| 107 | Ga0466704_168533 | 3300042643 | Bacteria | 6043 |
| 108 | Ga0466709_343858 | 3300042648 | Bacteria | 2343 |
| 109 | Ga0466727_133166 | 3300042655 | Bacteria | 7650 |
| 110 | Ga0466712_294506 | 3300042614 | Bacteria | 4508 |
| 111 | Ga0466711_134856 | 3300042615 | Bacteria | 2277 |
| 112 | Ga0466711_139186 | 3300042615 | Bacteria | 22031 |
| 113 | Ga0466711_279233 | 3300042615 | Bacteria | 4664 |
| 114 | Ga0466715_053438 | 3300042616 | Unclassified | 15686 |
| 115 | Ga0466715_466787 | 3300042616 | Bacteria | 13785 |
| 116 | Ga0466723_072821 | 3300042618 | Bacteria | 15618 |
| 117 | Ga0466723_157927 | 3300042618 | Unclassified | 10307 |
| 118 | Ga0466726_214020 | 3300042619 | Bacteria | 1426 |
| 119 | Ga0466726_244454 | 3300042619 | Bacteria | 1751 |
| 120 | Ga0466728_248876 | 3300042620 | Bacteria | 7842 |
| 121 | Ga0466729_085399 | 3300042621 | Bacteria | 1935 |
| 122 | Ga0415639_102646 | 3300038395 | Bacteria | 1548 |
| 123 | Ga0466696_462768 | 3300042596 | Bacteria | 1314 |
| 124 | Ga0466707_422916 | 3300042601 | Bacteria | 2725 |
| 125 | Ga0466716_243287 | 3300042605 | Bacteria | 3719 |
| 126 | Ga0466716_317483 | 3300042605 | Bacteria | 12875 |
| 127 | Ga0466719_115716 | 3300042606 | Bacteria | 12559 |
| 128 | Ga0123355_10100008 | 3300009826 | Bacteria | 4568 |
| 129 | Ga0123353_10023519 | 3300010167 | Bacteria | 9331 |
| 130 | Ga0562377_0373 | 3300056842 | Unclassified | 83266 |
| 131 | Ga0562375_0301 | 3300056856 | Bacteria | 123351 |
| 132 | IMNBGM34_c003630 | 3300000036 | Bacteria | 2117 |
| 133 | Ga0063521_1001514 | 3300003973 | Bacteria | 6256 |
| 134 | Ga0104041_1001388 | 3300007106 | Unclassified | 3313 |
| 135 | Ga0123357_10000959 | 3300009784 | Bacteria | 29372 |
| 136 | Ga0466697_228196 | 3300042611 | Bacteria | 2519 |
| 137 | Ga0466705_166368 | 3300042612 | Bacteria | 21906 |
| 138 | Ga0466705_246876 | 3300042612 | Bacteria | 4439 |
| 139 | Ga0466705_299347 | 3300042612 | Unclassified | 14841 |
| 140 | Ga0466703_094725 | 3300042636 | Bacteria | 8817 |
| 141 | Ga0466703_144679 | 3300042636 | Bacteria | 4158 |
| 142 | Ga0466704_082300 | 3300042643 | Unclassified | 5709 |
| 143 | Ga0466709_123793 | 3300042648 | Unclassified | 1957 |
| 144 | Ga0466709_266798 | 3300042648 | Unclassified | 3770 |
| 145 | Ga0466710_412976 | 3300042613 | Bacteria | 1430 |
| 146 | Ga0466711_339349 | 3300042615 | Bacteria | 26147 |
| 147 | Ga0466715_126005 | 3300042616 | Bacteria | 6706 |
| 148 | Ga0466723_073294 | 3300042618 | Bacteria | 13323 |
| 149 | Ga0466723_233774 | 3300042618 | Unclassified | 8217 |
| 150 | Ga0466723_255739 | 3300042618 | Bacteria | 2856 |
| 151 | Ga0466726_039170 | 3300042619 | Bacteria | 4120 |
| 152 | Ga0466726_176009 | 3300042619 | Bacteria | 2071 |
| 153 | Ga0466728_276474 | 3300042620 | Bacteria | 1743 |
| 154 | Ga0233288_1045890 | 3300022232 | Bacteria | 1542 |
| 155 | Ga0466690_154147 | 3300042590 | Unclassified | 3111 |
| 156 | Ga0466691_106546 | 3300042593 | Bacteria | 4941 |
| 157 | Ga0466691_141839 | 3300042593 | Bacteria | 6485 |
| 158 | Ga0466695_304708 | 3300042595 | Bacteria | 1515 |
| 159 | Ga0466716_123299 | 3300042605 | Bacteria | 4410 |
| 160 | Ga0466698_426282 | 3300042610 | Bacteria | 34482 |
| 161 | Ga0123353_10134516 | 3300010167 | Bacteria | 3965 |
| 162 | Ga0123353_10435510 | 3300010167 | Bacteria | 1936 |
| 163 | Ga0123353_10442877 | 3300010167 | Bacteria | 1916 |
| 164 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 165 | JGI24702J35022_10036858 | 3300002462 | Bacteria | 2613 |
| 166 | Ga0466705_215474 | 3300042612 | Unclassified | 4622 |
| 167 | Ga0466730_079838 | 3300042625 | Bacteria | 2700 |
| 168 | Ga0466703_060919 | 3300042636 | Bacteria | 17743 |
| 169 | Ga0466708_065072 | 3300042652 | Bacteria | 16015 |
| 170 | Ga0466708_199999 | 3300042652 | Unclassified | 14309 |
| 171 | Ga0466708_208365 | 3300042652 | Bacteria | 16728 |
| 172 | Ga0466708_374682 | 3300042652 | Archaea | 2414 |
| 173 | Ga0466725_441002 | 3300042654 | Bacteria | 4612 |
| 174 | Ga0466705_498878 | 3300042612 | Unclassified | 1319 |
| 175 | Ga0466711_413753 | 3300042615 | Bacteria | 12839 |
| 176 | Ga0466715_193474 | 3300042616 | Bacteria | 9949 |
| 177 | Ga0466715_405513 | 3300042616 | Bacteria | 2701 |
| 178 | Ga0466723_232651 | 3300042618 | Bacteria | 2551 |
| 179 | Ga0160434_104437 | 3300012850 | Bacteria | 2340 |
| 180 | Ga0466690_103091 | 3300042590 | Bacteria | 10436 |
| 181 | Ga0466690_151490 | 3300042590 | Bacteria | 1595 |
| 182 | Ga0466691_017540 | 3300042593 | Bacteria | 30787 |
| 183 | Ga0466691_075124 | 3300042593 | Bacteria | 3897 |
| 184 | Ga0466696_318270 | 3300042596 | Unclassified | 1703 |
| 185 | Ga0466707_250026 | 3300042601 | Bacteria | 4142 |
| 186 | Ga0466714_063902 | 3300042603 | Bacteria | 1044 |
| 187 | Ga0466716_126659 | 3300042605 | Bacteria | 7832 |
| 188 | Ga0466716_156828 | 3300042605 | Unclassified | 1428 |
| 189 | Ga0466719_340465 | 3300042606 | Bacteria | 5747 |
| 190 | Ga0466722_035052 | 3300042609 | Bacteria | 1554 |
| 191 | Ga0466722_197926 | 3300042609 | Bacteria | 4574 |
| 192 | Ga0123353_10000486 | 3300010167 | Bacteria | 49107 |
| 193 | Ga0123353_10060040 | 3300010167 | Bacteria | 6099 |
| 194 | Ga0562379_0042 | 3300056790 | Bacteria | 604795 |
| 195 | Ga0562375_0246 | 3300056856 | Bacteria | 147023 |
| 196 | IMNBL1DRAFT_c0000123 | 3300000062 | Bacteria | 69107 |
| 197 | Ga0102734_1000523 | 3300007129 | Bacteria | 10894 |
| 198 | Ga0466705_387338 | 3300042612 | Bacteria | 3424 |
| 199 | Ga0466703_153102 | 3300042636 | Bacteria | 29792 |
| 200 | Ga0466703_279892 | 3300042636 | Bacteria | 26432 |
| 201 | Ga0466704_276252 | 3300042643 | Bacteria | 15592 |
| 202 | Ga0466704_289958 | 3300042643 | Bacteria | 10970 |
| 203 | Ga0466705_484458 | 3300042612 | Bacteria | 2798 |
| 204 | Ga0466711_228941 | 3300042615 | Bacteria | 5343 |
| 205 | Ga0466715_020945 | 3300042616 | Bacteria | 11382 |
| 206 | Ga0466715_154900 | 3300042616 | Unclassified | 5231 |
| 207 | Ga0466723_011252 | 3300042618 | Bacteria | 2267 |
| 208 | Ga0466723_189207 | 3300042618 | Bacteria | 12898 |
| 209 | Ga0466723_257824 | 3300042618 | Bacteria | 8715 |
| 210 | Ga0466726_282738 | 3300042619 | Bacteria | 2746 |
| 211 | Ga0466726_380377 | 3300042619 | Bacteria | 2483 |
| 212 | Ga0466691_008918 | 3300042593 | Unclassified | 5176 |
| 213 | Ga0466691_027208 | 3300042593 | Bacteria | 6038 |
| 214 | Ga0466691_041645 | 3300042593 | Bacteria | 17236 |
| 215 | Ga0466699_043932 | 3300042597 | Bacteria | 1415 |
| 216 | Ga0466719_226725 | 3300042606 | Bacteria | 3903 |
| 217 | Ga0466719_528391 | 3300042606 | Unclassified | 7570 |
| 218 | Ga0123356_10003217 | 3300010049 | Bacteria | 17156 |
| 219 | Ga0123353_10264539 | 3300010167 | Bacteria | 2654 |
| 220 | Ga0123353_10306675 | 3300010167 | Bacteria | 2419 |
| 221 | Ga0123353_10913822 | 3300010167 | Bacteria | 1193 |
| 222 | CVPL010L_1000763 | 3300002932 | Bacteria | 11954 |
| 223 | Ga0103264_1000297 | 3300007188 | Bacteria | 27258 |
| 224 | Ga0466729_257257 | 3300042621 | Bacteria | 1374 |
| 225 | Ga0466730_096926 | 3300042625 | Bacteria | 2543 |
| 226 | Ga0466703_071442 | 3300042636 | Bacteria | 8055 |
| 227 | Ga0466703_200680 | 3300042636 | Bacteria | 50831 |
| 228 | Ga0466704_067233 | 3300042643 | Bacteria | 5915 |
| 229 | Ga0466704_618182 | 3300042643 | Bacteria | 14484 |
| 230 | Ga0466709_009484 | 3300042648 | Bacteria | 7898 |
| 231 | Ga0466709_068654 | 3300042648 | Bacteria | 41681 |
| 232 | Ga0466709_170462 | 3300042648 | Unclassified | 7005 |
| 233 | Ga0466724_07514 | 3300042649 | Bacteria | 2142 |
| 234 | Ga0466708_133016 | 3300042652 | Bacteria | 45331 |
| 235 | Ga0466708_337189 | 3300042652 | Unclassified | 3632 |
| 236 | Ga0466708_401324 | 3300042652 | Unclassified | 20599 |
| 237 | Ga0466727_288185 | 3300042655 | Bacteria | 10608 |
| 238 | Ga0466711_007967 | 3300042615 | Bacteria | 23939 |
| 239 | Ga0466715_059966 | 3300042616 | Bacteria | 20958 |
| 240 | Ga0466715_083532 | 3300042616 | Bacteria | 6382 |
| 241 | Ga0466715_383882 | 3300042616 | Bacteria | 1792 |
| 242 | Ga0466718_022855 | 3300042617 | Bacteria | 1035 |
| 243 | Ga0466723_120152 | 3300042618 | Bacteria | 26361 |
| 244 | Ga0466723_154657 | 3300042618 | Unclassified | 4963 |
| 245 | Ga0466726_151259 | 3300042619 | Bacteria | 4514 |
| 246 | Ga0466726_266580 | 3300042619 | Bacteria | 5205 |
| 247 | Ga0466728_035749 | 3300042620 | Bacteria | 13937 |
| 248 | Ga0466728_102099 | 3300042620 | Bacteria | 1263 |
| 249 | Ga0415639_222421 | 3300038395 | Bacteria | 7109 |
| 250 | Ga0466690_005766 | 3300042590 | Bacteria | 20865 |
| 251 | Ga0466691_125507 | 3300042593 | Bacteria | 45141 |
| 252 | Ga0466696_205180 | 3300042596 | Bacteria | 4310 |
| 253 | Ga0466696_235228 | 3300042596 | Bacteria | 2832 |
| 254 | Ga0466696_433240 | 3300042596 | Bacteria | 9085 |
| 255 | Ga0466706_276025 | 3300042599 | Bacteria | 4194 |
| 256 | Ga0466716_229802 | 3300042605 | Bacteria | 11916 |
| 257 | Ga0466716_251399 | 3300042605 | Bacteria | 22558 |
| 258 | Ga0466716_261207 | 3300042605 | Bacteria | 2454 |
| 259 | Ga0466719_455083 | 3300042606 | Bacteria | 33447 |
| 260 | Ga0466720_091793 | 3300042607 | Bacteria | 3117 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00676 | GO:0016624 | oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.