Protein Family IF09222
Metagenome
Isolate
250
Members
84
Samples
215
Scaffolds
181.97
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_257020|Ga0466703_257020_11814_12434
- Length
- 206 aa
- Sequence
- MSVKDTNVFERGSDVADRENAERDLPVTVRRDVNTVLAGFGGQGILFMGKVIAYAGLLDGREVSWLPSYGPEMRGGTANCSVCISDAQIGCPLVTAPDALIVMNQPSFEKFVPTVKPGGVIVVESSIITAKVECNNVAVHYVPATTLAEQHGLKGLANIILMGKLLAAAGFCSVETMTETIKKIVPARKAHLIPKNIEAIELGMKA
Sample Types
Isolate
14.0%
Metagenome
86.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
43.4%
Termitidae
34.9%
Kalotermitidae
10.8%
Rhinotermitidae
3.6%
Termopsidae
3.6%
Passalidae
2.4%
Hodotermitidae
1.2%
Taxonomy
Archaea
12
Bacteria
216
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 2 | 2773857681 | Unclassified Methanomassiliicoccaceae Lab288P1bin114 | Isolate | Unclassified |
| 3 | 2791354849 | Unclassified Chloroflexi Lab288P3bin29 | Isolate | Unclassified |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 15 | 2820822094 | Unclassified Actinobacteria Nt197P3bin131 | Isolate | Unclassified |
| 16 | 2820852808 | Unclassified Actinobacteria Lab288P3bin25 | Isolate | Unclassified |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 2773857697 | Unclassified Methanomassiliicoccaceae Th196P4bin34 | Isolate | Unclassified |
| 19 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 20 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 2820836992 | Unclassified Actinobacteria Lab288P4bin32 | Isolate | Unclassified |
| 23 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 24 | 2773857678 | Unclassified Methanomassiliicoccaceae Co191P4bin17 | Isolate | Unclassified |
| 25 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 26 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 27 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 40 | 2773857688 | Unclassified Methanomassiliicoccaceae Nt197P3bin45 | Isolate | Unclassified |
| 41 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 42 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 45 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 46 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 47 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 48 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 49 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 50 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 51 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 52 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 53 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 54 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 55 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 56 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 57 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 58 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 59 | 2773857690 | Unclassified Methanomassiliicoccaceae Nt197P4bin30 | Isolate | Unclassified |
| 60 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 61 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 62 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 63 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 64 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 65 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 66 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 67 | 2820874551 | Unclassified Actinobacteria Lab288P1bin85 | Isolate | Unclassified |
| 68 | 2773857686 | Unclassified Methanomassiliicoccaceae Lab288P4bin70 | Isolate | Unclassified |
| 69 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 70 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 71 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 2820799971 | Unclassified Actinobacteria Th196P4bin46 | Isolate | Unclassified |
| 75 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 76 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 77 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 78 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 79 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 80 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 81 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 82 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 83 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 84 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBL1DRAFT_c0011829 | 3300000062 | Bacteria | 4042 |
| 2 | Ga0072940_1000599 | 3300005200 | Bacteria | 1618 |
| 3 | Ga0072941_1351381 | 3300005201 | Bacteria | 1269 |
| 4 | Ga0466726_034473 | 3300042619 | Bacteria | 2272 |
| 5 | Ga0466726_046534 | 3300042619 | Bacteria | 8790 |
| 6 | Ga0466729_180436 | 3300042621 | Bacteria | 25741 |
| 7 | Ga0466731_263273 | 3300042622 | Bacteria | 2679 |
| 8 | Ga0466702_131380 | 3300042635 | Bacteria | 61952 |
| 9 | Ga0466703_257020 | 3300042636 | Bacteria | 22088 |
| 10 | Ga0466703_362993 | 3300042636 | Bacteria | 6688 |
| 11 | Ga0466704_029346 | 3300042643 | Unclassified | 2036 |
| 12 | Ga0466708_467090 | 3300042652 | Bacteria | 8800 |
| 13 | Ga0466656_241632 | 3300042550 | Bacteria | 2380 |
| 14 | Ga0466693_009000 | 3300042592 | Bacteria | 3125 |
| 15 | Ga0466696_437899 | 3300042596 | Bacteria | 1392 |
| 16 | Ga0123356_10083154 | 3300010049 | Bacteria | 3032 |
| 17 | Ga0123356_11803673 | 3300010049 | Bacteria | 760 |
| 18 | Ga0123353_10108656 | 3300010167 | Bacteria | 4470 |
| 19 | Ga0123353_10136819 | 3300010167 | Bacteria | 3929 |
| 20 | Ga0123353_10344135 | 3300010167 | Unclassified | 2251 |
| 21 | Ga0123353_10757766 | 3300010167 | Bacteria | 1350 |
| 22 | Ga0123353_10854614 | 3300010167 | Bacteria | 1247 |
| 23 | Ga0123353_10861542 | 3300010167 | Bacteria | 1240 |
| 24 | Ga0123354_10349469 | 3300010882 | Bacteria | 1320 |
| 25 | Ga0466701_026465 | 3300042598 | Bacteria | 2655 |
| 26 | Ga0466706_138091 | 3300042599 | Bacteria | 1285 |
| 27 | Ga0466700_171793 | 3300042600 | Bacteria | 1185 |
| 28 | Ga0466722_023479 | 3300042609 | Bacteria | 103035 |
| 29 | JGI24702J35022_10002880 | 3300002462 | Bacteria | 10413 |
| 30 | Ga0068302_10007562 | 3300005071 | Bacteria | 35919 |
| 31 | Ga0068302_10073790 | 3300005071 | Bacteria | 10453 |
| 32 | Ga0466711_152624 | 3300042615 | Bacteria | 2875 |
| 33 | Ga0466726_130446 | 3300042619 | Bacteria | 44133 |
| 34 | Ga0466726_185701 | 3300042619 | Bacteria | 5653 |
| 35 | Ga0466729_226083 | 3300042621 | Bacteria | 1407 |
| 36 | Ga0466731_148851 | 3300042622 | Archaea | 1737 |
| 37 | Ga0466692_026054 | 3300042591 | Bacteria | 1196 |
| 38 | Ga0466696_098533 | 3300042596 | Bacteria | 1159 |
| 39 | Ga0123356_10842337 | 3300010049 | Bacteria | 1088 |
| 40 | Ga0123356_11045864 | 3300010049 | Bacteria | 986 |
| 41 | Ga0123353_10006105 | 3300010167 | Bacteria | 15983 |
| 42 | Ga0123353_10013643 | 3300010167 | Bacteria | 11651 |
| 43 | Ga0123353_10023406 | 3300010167 | Bacteria | 9351 |
| 44 | Ga0123353_10043220 | 3300010167 | Bacteria | 7138 |
| 45 | Ga0123353_10468040 | 3300010167 | Unclassified | 1849 |
| 46 | Ga0123353_11234149 | 3300010167 | Bacteria | 977 |
| 47 | Ga0466714_148109 | 3300042603 | Bacteria | 1561 |
| 48 | Ga0466697_215994 | 3300042611 | Bacteria | 26995 |
| 49 | IMNBL1DRAFT_c0027340 | 3300000062 | Bacteria | 2147 |
| 50 | JGI24696J40584_12952411 | 3300002834 | Bacteria | 2344 |
| 51 | JGI24696J40584_12961662 | 3300002834 | Archaea | 30438 |
| 52 | Ga0123357_10001203 | 3300009784 | Archaea | 27053 |
| 53 | Ga0466729_261728 | 3300042621 | Bacteria | 1263 |
| 54 | Ga0466703_379622 | 3300042636 | Bacteria | 1009 |
| 55 | Ga0466704_233534 | 3300042643 | Bacteria | 2754 |
| 56 | Ga0466704_407626 | 3300042643 | Bacteria | 11178 |
| 57 | Ga0466725_221144 | 3300042654 | Bacteria | 2021 |
| 58 | Ga0415639_122210 | 3300038395 | Unclassified | 3047 |
| 59 | Ga0466692_038820 | 3300042591 | Bacteria | 13425 |
| 60 | Ga0466696_032251 | 3300042596 | Bacteria | 2297 |
| 61 | Ga0123356_10541908 | 3300010049 | Bacteria | 1324 |
| 62 | Ga0123353_10000855 | 3300010167 | Bacteria | 37005 |
| 63 | Ga0123353_10001802 | 3300010167 | Bacteria | 26346 |
| 64 | Ga0123353_10011419 | 3300010167 | Bacteria | 12515 |
| 65 | Ga0123353_10128787 | 3300010167 | Bacteria | 4064 |
| 66 | Ga0123353_10214230 | 3300010167 | Bacteria | 3018 |
| 67 | Ga0123353_11018858 | 3300010167 | Bacteria | 1110 |
| 68 | Ga0466706_263198 | 3300042599 | Unclassified | 2655 |
| 69 | Ga0466717_036084 | 3300042604 | Bacteria | 22107 |
| 70 | Ga0466717_171512 | 3300042604 | Bacteria | 11462 |
| 71 | Ga0466722_063805 | 3300042609 | Bacteria | 20758 |
| 72 | Ga0466698_446567 | 3300042610 | Unclassified | 2453 |
| 73 | Ga0466705_056452 | 3300042612 | Bacteria | 8285 |
| 74 | JGI24695J34938_10041624 | 3300002450 | Bacteria | 2062 |
| 75 | JGI24705J35276_12196581 | 3300002504 | Unclassified | 1542 |
| 76 | Ga0466705_471564 | 3300042612 | Bacteria | 28580 |
| 77 | Ga0466711_235346 | 3300042615 | Bacteria | 5665 |
| 78 | Ga0466718_117141 | 3300042617 | Unclassified | 1412 |
| 79 | Ga0466702_129145 | 3300042635 | Bacteria | 18302 |
| 80 | Ga0466724_63607 | 3300042649 | Bacteria | 1931 |
| 81 | Ga0466696_129950 | 3300042596 | Bacteria | 20332 |
| 82 | Ga0123357_10067114 | 3300009784 | Bacteria | 4781 |
| 83 | Ga0123356_10035815 | 3300010049 | Bacteria | 4634 |
| 84 | Ga0123356_10155193 | 3300010049 | Bacteria | 2279 |
| 85 | Ga0123356_10293117 | 3300010049 | Bacteria | 1728 |
| 86 | Ga0123356_10918276 | 3300010049 | Bacteria | 1047 |
| 87 | Ga0123353_10006881 | 3300010167 | Bacteria | 15267 |
| 88 | Ga0123353_10138871 | 3300010167 | Bacteria | 3895 |
| 89 | Ga0123353_10283303 | 3300010167 | Bacteria | 2543 |
| 90 | Ga0123353_10661165 | 3300010167 | Unclassified | 1477 |
| 91 | Ga0123354_10008142 | 3300010882 | Bacteria | 15915 |
| 92 | Ga0123354_10416580 | 3300010882 | Bacteria | 1121 |
| 93 | Ga0466701_031190 | 3300042598 | Unclassified | 1538 |
| 94 | Ga0466706_001485 | 3300042599 | Bacteria | 8842 |
| 95 | Ga0466706_120432 | 3300042599 | Bacteria | 12087 |
| 96 | Ga0466706_188895 | 3300042599 | Bacteria | 6660 |
| 97 | Ga0466713_043605 | 3300042602 | Bacteria | 65246 |
| 98 | Ga0466698_089250 | 3300042610 | Bacteria | 1270 |
| 99 | Ga0466697_213154 | 3300042611 | Bacteria | 3701 |
| 100 | Ga0466705_101192 | 3300042612 | Bacteria | 3302 |
| 101 | Ga0466705_386375 | 3300042612 | Bacteria | 3858 |
| 102 | 2227080804 | 2225789004 | Bacteria | 40439 |
| 103 | IMNBL1DRAFT_c0002418 | 3300000062 | Bacteria | 12993 |
| 104 | JGI24702J35022_10025934 | 3300002462 | Bacteria | 3161 |
| 105 | JGI24702J35022_10027986 | 3300002462 | Bacteria | 3032 |
| 106 | Ga0466710_158181 | 3300042613 | Bacteria | 12935 |
| 107 | Ga0466718_050665 | 3300042617 | Bacteria | 16279 |
| 108 | Ga0466704_031970 | 3300042643 | Unclassified | 1650 |
| 109 | Ga0466704_102621 | 3300042643 | Bacteria | 1749 |
| 110 | Ga0466704_510086 | 3300042643 | Bacteria | 6709 |
| 111 | Ga0466708_076442 | 3300042652 | Bacteria | 53681 |
| 112 | Ga0466708_182098 | 3300042652 | Bacteria | 3560 |
| 113 | Ga0466727_338245 | 3300042655 | Bacteria | 3190 |
| 114 | Ga0415639_027630 | 3300038395 | Bacteria | 14791 |
| 115 | Ga0415639_192615 | 3300038395 | Unclassified | 1138 |
| 116 | Ga0466657_015425 | 3300042582 | Bacteria | 7852 |
| 117 | Ga0466692_106690 | 3300042591 | Bacteria | 6613 |
| 118 | Ga0123356_10021054 | 3300010049 | Bacteria | 6167 |
| 119 | Ga0123356_10194838 | 3300010049 | Bacteria | 2061 |
| 120 | Ga0123356_11460309 | 3300010049 | Bacteria | 843 |
| 121 | Ga0466706_104032 | 3300042599 | Bacteria | 1036 |
| 122 | Ga0466706_221472 | 3300042599 | Bacteria | 2339 |
| 123 | Ga0466707_141726 | 3300042601 | Bacteria | 8502 |
| 124 | Ga0466716_458259 | 3300042605 | Bacteria | 4042 |
| 125 | Ga0466719_247182 | 3300042606 | Bacteria | 37884 |
| 126 | Ga0466698_448637 | 3300042610 | Bacteria | 13647 |
| 127 | Ga0466705_206326 | 3300042612 | Bacteria | 3584 |
| 128 | 2227610738 | 2225789004 | Archaea | 12069 |
| 129 | IMNBL1DRAFT_c0014876 | 3300000062 | Bacteria | 3405 |
| 130 | JGI24702J35022_10004320 | 3300002462 | Bacteria | 8472 |
| 131 | JGI24705J35276_12199292 | 3300002504 | Bacteria | 1583 |
| 132 | Ga0072940_1027809 | 3300005200 | Bacteria | 6658 |
| 133 | Ga0466710_246718 | 3300042613 | Bacteria | 2911 |
| 134 | Ga0466729_000677 | 3300042621 | Bacteria | 3725 |
| 135 | Ga0466729_249091 | 3300042621 | Unclassified | 1304 |
| 136 | Ga0466704_578252 | 3300042643 | Bacteria | 11375 |
| 137 | Ga0466708_287109 | 3300042652 | Bacteria | 40724 |
| 138 | Ga0466725_265300 | 3300042654 | Bacteria | 1744 |
| 139 | Ga0123355_10091542 | 3300009826 | Bacteria | 4821 |
| 140 | Ga0123356_10000019 | 3300010049 | Bacteria | 179881 |
| 141 | Ga0123356_10001877 | 3300010049 | Bacteria | 22775 |
| 142 | Ga0123356_10092077 | 3300010049 | Bacteria | 2891 |
| 143 | Ga0123353_10815177 | 3300010167 | Unclassified | 1286 |
| 144 | Ga0123353_11345518 | 3300010167 | Bacteria | 923 |
| 145 | Ga0123353_11403976 | 3300010167 | Bacteria | 897 |
| 146 | Ga0123353_12317173 | 3300010167 | Unclassified | 645 |
| 147 | Ga0466701_070057 | 3300042598 | Bacteria | 5468 |
| 148 | Ga0466706_008698 | 3300042599 | Bacteria | 1260 |
| 149 | Ga0466706_115237 | 3300042599 | Bacteria | 1566 |
| 150 | Ga0466700_036760 | 3300042600 | Bacteria | 1488 |
| 151 | Ga0466707_136862 | 3300042601 | Unclassified | 2908 |
| 152 | Ga0466707_191061 | 3300042601 | Bacteria | 6482 |
| 153 | Ga0466707_421950 | 3300042601 | Bacteria | 1000 |
| 154 | Ga0466714_114540 | 3300042603 | Bacteria | 1775 |
| 155 | Ga0466719_384122 | 3300042606 | Bacteria | 18818 |
| 156 | Ga0466733_184413 | 3300042659 | Bacteria | 1780 |
| 157 | JGI24695J34938_10154611 | 3300002450 | Bacteria | 941 |
| 158 | JGI24705J35276_12236952 | 3300002504 | Bacteria | 9412 |
| 159 | Ga0466734_053401 | 3300042623 | Bacteria | 30585 |
| 160 | Ga0466704_154077 | 3300042643 | Bacteria | 4690 |
| 161 | Ga0466708_038376 | 3300042652 | Bacteria | 4978 |
| 162 | Ga0415639_008547 | 3300038395 | Bacteria | 1234 |
| 163 | Ga0466657_318298 | 3300042582 | Bacteria | 2176 |
| 164 | Ga0123357_10102333 | 3300009784 | Bacteria | 3688 |
| 165 | Ga0123356_10004472 | 3300010049 | Bacteria | 14442 |
| 166 | Ga0123356_10934761 | 3300010049 | Unclassified | 1038 |
| 167 | Ga0123353_10190255 | 3300010167 | Bacteria | 3240 |
| 168 | Ga0123353_10448323 | 3300010167 | Bacteria | 1901 |
| 169 | Ga0123353_10863485 | 3300010167 | Bacteria | 1238 |
| 170 | Ga0123353_11311294 | 3300010167 | Unclassified | 939 |
| 171 | Ga0466701_053308 | 3300042598 | Bacteria | 2558 |
| 172 | Ga0466706_036494 | 3300042599 | Bacteria | 4260 |
| 173 | Ga0466706_064883 | 3300042599 | Bacteria | 3930 |
| 174 | Ga0466706_156744 | 3300042599 | Bacteria | 14182 |
| 175 | Ga0466706_284039 | 3300042599 | Bacteria | 27694 |
| 176 | Ga0466700_423784 | 3300042600 | Bacteria | 2835 |
| 177 | Ga0466707_060981 | 3300042601 | Bacteria | 1847 |
| 178 | Ga0466707_218507 | 3300042601 | Bacteria | 2052 |
| 179 | Ga0466713_091039 | 3300042602 | Bacteria | 27124 |
| 180 | Ga0466714_045203 | 3300042603 | Bacteria | 1786 |
| 181 | Ga0466719_194686 | 3300042606 | Bacteria | 83646 |
| 182 | Ga0466697_199877 | 3300042611 | Bacteria | 1239 |
| 183 | Ga0466705_013488 | 3300042612 | Bacteria | 4031 |
| 184 | JGI24702J35022_10016059 | 3300002462 | Bacteria | 4109 |
| 185 | JGI24699J35502_11046159 | 3300002509 | Bacteria | 1613 |
| 186 | Ga0466711_272827 | 3300042615 | Bacteria | 2130 |
| 187 | Ga0466715_191158 | 3300042616 | Bacteria | 24432 |
| 188 | Ga0466729_140094 | 3300042621 | Bacteria | 1349 |
| 189 | Ga0466729_143465 | 3300042621 | Bacteria | 36612 |
| 190 | Ga0466703_289148 | 3300042636 | Bacteria | 257603 |
| 191 | Ga0466704_488487 | 3300042643 | Bacteria | 2726 |
| 192 | Ga0466708_025234 | 3300042652 | Bacteria | 4649 |
| 193 | Ga0466708_038566 | 3300042652 | Unclassified | 1834 |
| 194 | Ga0415639_112267 | 3300038395 | Bacteria | 3571 |
| 195 | Ga0466656_072603 | 3300042550 | Archaea | 20980 |
| 196 | Ga0466657_060019 | 3300042582 | Bacteria | 1025 |
| 197 | Ga0466692_155903 | 3300042591 | Bacteria | 21891 |
| 198 | Ga0466693_171883 | 3300042592 | Bacteria | 1811 |
| 199 | Ga0123356_10037941 | 3300010049 | Bacteria | 4491 |
| 200 | Ga0123356_10048381 | 3300010049 | Bacteria | 3957 |
| 201 | Ga0123356_11206757 | 3300010049 | Unclassified | 922 |
| 202 | Ga0123353_10001336 | 3300010167 | Archaea | 30223 |
| 203 | Ga0123353_10010673 | 3300010167 | Bacteria | 12838 |
| 204 | Ga0123353_10209379 | 3300010167 | Unclassified | 3060 |
| 205 | Ga0123353_10351669 | 3300010167 | Bacteria | 2220 |
| 206 | Ga0123354_10024132 | 3300010882 | Bacteria | 9595 |
| 207 | Ga0123354_10361295 | 3300010882 | Bacteria | 1280 |
| 208 | Ga0466706_023570 | 3300042599 | Bacteria | 5019 |
| 209 | Ga0466706_123632 | 3300042599 | Unclassified | 1038 |
| 210 | Ga0466706_232051 | 3300042599 | Bacteria | 1962 |
| 211 | Ga0466707_216727 | 3300042601 | Bacteria | 7013 |
| 212 | Ga0466713_006978 | 3300042602 | Bacteria | 198429 |
| 213 | Ga0466714_037189 | 3300042603 | Bacteria | 6575 |
| 214 | Ga0466719_134466 | 3300042606 | Bacteria | 4500 |
| 215 | Ga0466719_512092 | 3300042606 | Bacteria | 14950 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01558 | POR | Pyruvate ferredoxin/flavodoxin oxidoreductase | 41 | 204 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01558 | GO:0016903 | oxidoreductase activity, acting on the aldehyde or oxo group of donors | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.