Protein Family IF09180
Metagenome
Metatranscriptome
Isolate
241
Members
64
Samples
235
Scaffolds
61.73
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_188624|Ga0466703_188624_198_410
- Length
- 70 aa
- Sequence
- MEWQMPKMKTKKSAAKRYSFTGTGKVKYKKQNLRHILTKKSAKRKRNLRQGGILSGDNVSVIKKQLLPYG
Sample Types
Isolate
2.5%
Metagenome
95.4%
MAG
0.0%
Metatranscriptome
2.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.5%
Kalotermitidae
23.0%
Unclassified
14.8%
Rhinotermitidae
6.6%
Termopsidae
6.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
202
Eukaryota
0
Viruses
0
Unclassified
39
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 2 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 22 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 44 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 45 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 46 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 49 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 56 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 57 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 58 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 59 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 60 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 61 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 62 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 63 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 64 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_132222 | 3300042615 | Bacteria | 15378 |
| 2 | Ga0466711_436706 | 3300042615 | Bacteria | 1679 |
| 3 | Ga0466718_066050 | 3300042617 | Bacteria | 21250 |
| 4 | Ga0466718_167350 | 3300042617 | Bacteria | 3911 |
| 5 | Ga0466705_148181 | 3300042612 | Bacteria | 9794 |
| 6 | Ga0466733_059144 | 3300042659 | Bacteria | 3242 |
| 7 | Ga0264413_112336 | 3300024493 | Unclassified | 1370 |
| 8 | Ga0466699_427968 | 3300042597 | Bacteria | 5289 |
| 9 | JGI24698J34947_10134780 | 3300002449 | Bacteria | 1050 |
| 10 | Ga0466729_208161 | 3300042621 | Bacteria | 5876 |
| 11 | Ga0466735_090027 | 3300042624 | Bacteria | 1020 |
| 12 | Ga0466703_292396 | 3300042636 | Bacteria | 5907 |
| 13 | Ga0466704_245908 | 3300042643 | Bacteria | 5553 |
| 14 | Ga0466708_029334 | 3300042652 | Bacteria | 4736 |
| 15 | Ga0466727_198830 | 3300042655 | Bacteria | 1992 |
| 16 | Ga0466727_292532 | 3300042655 | Bacteria | 1761 |
| 17 | Ga0466727_345077 | 3300042655 | Bacteria | 5699 |
| 18 | Ga0123353_10185541 | 3300010167 | Bacteria | 3289 |
| 19 | Ga0123353_11582569 | 3300010167 | Bacteria | 829 |
| 20 | Ga0123353_11635457 | 3300010167 | Bacteria | 811 |
| 21 | Ga0123354_10294849 | 3300010882 | Unclassified | 1546 |
| 22 | Ga0466706_137331 | 3300042599 | Bacteria | 1843 |
| 23 | Ga0466719_102728 | 3300042606 | Bacteria | 3955 |
| 24 | Ga0466722_052189 | 3300042609 | Bacteria | 29475 |
| 25 | Ga0466715_356871 | 3300042616 | Bacteria | 26175 |
| 26 | Ga0466723_061161 | 3300042618 | Bacteria | 56205 |
| 27 | Ga0466723_114548 | 3300042618 | Bacteria | 4478 |
| 28 | Ga0466726_369097 | 3300042619 | Bacteria | 1112 |
| 29 | Ga0466726_493342 | 3300042619 | Bacteria | 4833 |
| 30 | Ga0466728_107104 | 3300042620 | Bacteria | 10380 |
| 31 | Ga0255786_1000885 | 3300022815 | Bacteria | 2692 |
| 32 | Ga0466692_087270 | 3300042591 | Bacteria | 9112 |
| 33 | Ga0466694_069465 | 3300042594 | Bacteria | 8776 |
| 34 | Ga0466695_343480 | 3300042595 | Bacteria | 1308 |
| 35 | Ga0466696_129657 | 3300042596 | Bacteria | 12080 |
| 36 | AustNasuHG_c1061499 | 3300000089 | Bacteria | 724 |
| 37 | JGI24702J35022_10017618 | 3300002462 | Bacteria | 3902 |
| 38 | Ga0466730_078090 | 3300042625 | Unclassified | 1010 |
| 39 | Ga0466703_033816 | 3300042636 | Bacteria | 4416 |
| 40 | Ga0466703_043532 | 3300042636 | Bacteria | 16956 |
| 41 | Ga0466703_106697 | 3300042636 | Bacteria | 53394 |
| 42 | Ga0466703_238874 | 3300042636 | Bacteria | 12994 |
| 43 | Ga0466727_261047 | 3300042655 | Bacteria | 4146 |
| 44 | Ga0123353_12015447 | 3300010167 | Bacteria | 706 |
| 45 | Ga0466716_475498 | 3300042605 | Bacteria | 1874 |
| 46 | Ga0466719_121895 | 3300042606 | Bacteria | 15848 |
| 47 | Ga0466719_289864 | 3300042606 | Bacteria | 1103 |
| 48 | Ga0466722_114770 | 3300042609 | Bacteria | 67972 |
| 49 | Ga0466705_460580 | 3300042612 | Bacteria | 18473 |
| 50 | Ga0466712_030310 | 3300042614 | Unclassified | 1504 |
| 51 | Ga0466711_487470 | 3300042615 | Bacteria | 2421 |
| 52 | Ga0466715_055507 | 3300042616 | Bacteria | 3671 |
| 53 | Ga0466723_052853 | 3300042618 | Bacteria | 1984 |
| 54 | Ga0466723_075852 | 3300042618 | Bacteria | 5783 |
| 55 | Ga0466726_044203 | 3300042619 | Bacteria | 2117 |
| 56 | Ga0466726_053573 | 3300042619 | Bacteria | 7587 |
| 57 | Ga0466726_251363 | 3300042619 | Bacteria | 1461 |
| 58 | Ga0466726_282255 | 3300042619 | Bacteria | 2055 |
| 59 | Ga0466728_142401 | 3300042620 | Bacteria | 3963 |
| 60 | Ga0466729_001096 | 3300042621 | Bacteria | 1959 |
| 61 | Ga0466729_116662 | 3300042621 | Bacteria | 1190 |
| 62 | Ga0466733_103298 | 3300042659 | Bacteria | 18011 |
| 63 | Ga0456237_0000771 | 3300041968 | Bacteria | 4963 |
| 64 | Ga0466690_078912 | 3300042590 | Bacteria | 7112 |
| 65 | Ga0466690_109429 | 3300042590 | Bacteria | 13826 |
| 66 | Ga0466692_086305 | 3300042591 | Bacteria | 17507 |
| 67 | Ga0466692_108416 | 3300042591 | Bacteria | 1287 |
| 68 | Ga0466691_036935 | 3300042593 | Bacteria | 16681 |
| 69 | Ga0466691_226964 | 3300042593 | Bacteria | 4475 |
| 70 | Ga0466696_259712 | 3300042596 | Bacteria | 29051 |
| 71 | Ga0466696_312726 | 3300042596 | Bacteria | 5067 |
| 72 | JGI24695J34938_10005448 | 3300002450 | Bacteria | 7929 |
| 73 | JGI24695J34938_10007879 | 3300002450 | Bacteria | 6164 |
| 74 | JGI24695J34938_10014678 | 3300002450 | Bacteria | 4049 |
| 75 | Ga0466735_208266 | 3300042624 | Bacteria | 3858 |
| 76 | Ga0466703_188624 | 3300042636 | Bacteria | 2641 |
| 77 | Ga0466704_184197 | 3300042643 | Unclassified | 2083 |
| 78 | Ga0466727_086648 | 3300042655 | Unclassified | 4066 |
| 79 | Ga0123356_10362013 | 3300010049 | Bacteria | 1578 |
| 80 | Ga0123356_14086355 | 3300010049 | Bacteria | 502 |
| 81 | Ga0123353_10476225 | 3300010167 | Bacteria | 1828 |
| 82 | Ga0466719_038018 | 3300042606 | Unclassified | 2896 |
| 83 | Ga0466722_039516 | 3300042609 | Bacteria | 5884 |
| 84 | Ga0466722_061629 | 3300042609 | Bacteria | 5432 |
| 85 | Ga0466722_136257 | 3300042609 | Bacteria | 4274 |
| 86 | Ga0466722_189659 | 3300042609 | Bacteria | 4545 |
| 87 | Ga0466715_244540 | 3300042616 | Bacteria | 16421 |
| 88 | Ga0466715_264250 | 3300042616 | Bacteria | 16802 |
| 89 | Ga0466715_392245 | 3300042616 | Bacteria | 49927 |
| 90 | Ga0466718_031055 | 3300042617 | Unclassified | 9437 |
| 91 | Ga0466726_104069 | 3300042619 | Bacteria | 1296 |
| 92 | Ga0466726_202389 | 3300042619 | Unclassified | 3371 |
| 93 | Ga0466726_202898 | 3300042619 | Bacteria | 4572 |
| 94 | Ga0466726_318430 | 3300042619 | Bacteria | 1123 |
| 95 | Ga0466733_133182 | 3300042659 | Unclassified | 1933 |
| 96 | Ga0466690_380077 | 3300042590 | Unclassified | 4421 |
| 97 | Ga0466691_008419 | 3300042593 | Bacteria | 10429 |
| 98 | Ga0466696_301843 | 3300042596 | Bacteria | 2670 |
| 99 | Ga0466696_327345 | 3300042596 | Bacteria | 11315 |
| 100 | Ga0466699_030076 | 3300042597 | Bacteria | 8484 |
| 101 | FAAS_10825422 | 3300001880 | Bacteria | 583 |
| 102 | JGI24698J34947_10360027 | 3300002449 | Bacteria | 506 |
| 103 | JGI24702J35022_10001349 | 3300002462 | Bacteria | 15238 |
| 104 | JGI24702J35022_10352835 | 3300002462 | Bacteria | 880 |
| 105 | JGI24705J35276_11635789 | 3300002504 | Unclassified | 605 |
| 106 | Ga0072941_1047817 | 3300005201 | Bacteria | 2765 |
| 107 | Ga0466702_212580 | 3300042635 | Unclassified | 1549 |
| 108 | Ga0466704_108854 | 3300042643 | Bacteria | 24907 |
| 109 | Ga0466704_259139 | 3300042643 | Bacteria | 8397 |
| 110 | Ga0466709_108900 | 3300042648 | Unclassified | 1749 |
| 111 | Ga0466708_288804 | 3300042652 | Bacteria | 20693 |
| 112 | Ga0466727_303325 | 3300042655 | Bacteria | 1476 |
| 113 | Ga0123353_11890644 | 3300010167 | Bacteria | 737 |
| 114 | Ga0123353_12198323 | 3300010167 | Unclassified | 667 |
| 115 | Ga0466707_118039 | 3300042601 | Bacteria | 1362 |
| 116 | Ga0466717_252566 | 3300042604 | Unclassified | 1284 |
| 117 | Ga0466716_257069 | 3300042605 | Bacteria | 4308 |
| 118 | Ga0466719_128746 | 3300042606 | Bacteria | 9047 |
| 119 | Ga0466719_305302 | 3300042606 | Bacteria | 2487 |
| 120 | Ga0466719_344417 | 3300042606 | Bacteria | 8551 |
| 121 | Ga0466719_392338 | 3300042606 | Bacteria | 4755 |
| 122 | Ga0466712_056342 | 3300042614 | Bacteria | 1251 |
| 123 | Ga0466711_433891 | 3300042615 | Bacteria | 6384 |
| 124 | Ga0466715_534972 | 3300042616 | Bacteria | 7927 |
| 125 | Ga0466718_000664 | 3300042617 | Unclassified | 4458 |
| 126 | Ga0466723_116455 | 3300042618 | Bacteria | 47618 |
| 127 | Ga0466726_260426 | 3300042619 | Bacteria | 1929 |
| 128 | Ga0466728_144243 | 3300042620 | Bacteria | 10187 |
| 129 | Ga0466728_446572 | 3300042620 | Bacteria | 1294 |
| 130 | Ga0466705_004702 | 3300042612 | Bacteria | 5571 |
| 131 | Ga0223688_1022131 | 3300021227 | Unclassified | 551 |
| 132 | Ga0255786_1002404 | 3300022815 | Unclassified | 1662 |
| 133 | Ga0264413_106374 | 3300024493 | Unclassified | 6279 |
| 134 | Ga0466694_289480 | 3300042594 | Unclassified | 1123 |
| 135 | Ga0466699_437725 | 3300042597 | Bacteria | 1389 |
| 136 | AustNasuHG_c1031013 | 3300000089 | Bacteria | 1521 |
| 137 | AustNasuHG_c1070338 | 3300000089 | Unclassified | 633 |
| 138 | FAAS_10283594 | 3300001880 | Bacteria | 586 |
| 139 | JGI24698J34947_10025898 | 3300002449 | Bacteria | 3119 |
| 140 | JGI24695J34938_10006643 | 3300002450 | Bacteria | 6900 |
| 141 | JGI24695J34938_10006745 | 3300002450 | Bacteria | 6832 |
| 142 | JGI24695J34938_10018363 | 3300002450 | Bacteria | 3500 |
| 143 | JGI24695J34938_10021432 | 3300002450 | Bacteria | 3161 |
| 144 | JGI24695J34938_10033454 | 3300002450 | Bacteria | 2364 |
| 145 | JGI24696J40584_12841894 | 3300002834 | Bacteria | 957 |
| 146 | Ga0068302_10094065 | 3300005071 | Bacteria | 1287 |
| 147 | Ga0072941_1044436 | 3300005201 | Unclassified | 2206 |
| 148 | Ga0466735_014184 | 3300042624 | Bacteria | 11165 |
| 149 | Ga0466735_116096 | 3300042624 | Bacteria | 1620 |
| 150 | Ga0466735_197514 | 3300042624 | Bacteria | 1690 |
| 151 | Ga0466727_149030 | 3300042655 | Bacteria | 3465 |
| 152 | Ga0123355_11897805 | 3300009826 | Bacteria | 557 |
| 153 | Ga0123353_10239907 | 3300010167 | Bacteria | 2817 |
| 154 | Ga0123353_13153573 | 3300010167 | Unclassified | 530 |
| 155 | Ga0466716_183130 | 3300042605 | Bacteria | 5333 |
| 156 | Ga0466720_095942 | 3300042607 | Bacteria | 1698 |
| 157 | Ga0466698_444814 | 3300042610 | Unclassified | 1030 |
| 158 | Ga0466718_165178 | 3300042617 | Bacteria | 17037 |
| 159 | Ga0466728_275849 | 3300042620 | Bacteria | 2648 |
| 160 | Ga0233288_1005861 | 3300022232 | Bacteria | 858 |
| 161 | Ga0415639_083280 | 3300038395 | Bacteria | 9847 |
| 162 | Ga0466690_272394 | 3300042590 | Bacteria | 3849 |
| 163 | Ga0466690_272992 | 3300042590 | Bacteria | 1107 |
| 164 | Ga0466699_098141 | 3300042597 | Bacteria | 1520 |
| 165 | JGI24698J34947_10204284 | 3300002449 | Bacteria | 771 |
| 166 | JGI24695J34938_10000019 | 3300002450 | Bacteria | 113818 |
| 167 | JGI24695J34938_10008334 | 3300002450 | Bacteria | 5925 |
| 168 | JGI24695J34938_10233240 | 3300002450 | Bacteria | 776 |
| 169 | JGI24705J35276_11654486 | 3300002504 | Unclassified | 613 |
| 170 | Ga0466702_369616 | 3300042635 | Unclassified | 2419 |
| 171 | Ga0466704_171743 | 3300042643 | Bacteria | 9349 |
| 172 | Ga0466709_303144 | 3300042648 | Bacteria | 8359 |
| 173 | Ga0466708_259210 | 3300042652 | Bacteria | 7904 |
| 174 | Ga0123355_11985188 | 3300009826 | Unclassified | 540 |
| 175 | Ga0123353_10141984 | 3300010167 | Bacteria | 3845 |
| 176 | Ga0123353_11782028 | 3300010167 | Unclassified | 766 |
| 177 | Ga0466706_159039 | 3300042599 | Bacteria | 1350 |
| 178 | Ga0466706_273067 | 3300042599 | Bacteria | 1960 |
| 179 | Ga0466713_004086 | 3300042602 | Unclassified | 2810 |
| 180 | Ga0466719_063712 | 3300042606 | Bacteria | 26562 |
| 181 | Ga0466719_502440 | 3300042606 | Bacteria | 1435 |
| 182 | Ga0466720_177676 | 3300042607 | Bacteria | 91443 |
| 183 | Ga0466721_055967 | 3300042608 | Bacteria | 1089 |
| 184 | Ga0466722_178725 | 3300042609 | Bacteria | 2732 |
| 185 | Ga0466722_190265 | 3300042609 | Bacteria | 3685 |
| 186 | Ga0466698_396382 | 3300042610 | Bacteria | 1247 |
| 187 | Ga0466718_145740 | 3300042617 | Unclassified | 4574 |
| 188 | Ga0466723_161058 | 3300042618 | Bacteria | 5770 |
| 189 | Ga0222431_1000018 | 3300021190 | Bacteria | 1270 |
| 190 | Ga0466690_128251 | 3300042590 | Bacteria | 1959 |
| 191 | Ga0466692_167233 | 3300042591 | Bacteria | 2679 |
| 192 | JGI24698J34947_10008996 | 3300002449 | Bacteria | 5477 |
| 193 | JGI24695J34938_10068038 | 3300002450 | Unclassified | 1497 |
| 194 | JGI24702J35022_10011260 | 3300002462 | Unclassified | 4986 |
| 195 | JGI24702J35022_10380503 | 3300002462 | Bacteria | 849 |
| 196 | Ga0072941_1004833 | 3300005201 | Bacteria | 19559 |
| 197 | Ga0466729_254537 | 3300042621 | Bacteria | 2399 |
| 198 | Ga0466703_130931 | 3300042636 | Bacteria | 4349 |
| 199 | Ga0466704_142183 | 3300042643 | Bacteria | 3770 |
| 200 | Ga0466704_295368 | 3300042643 | Bacteria | 17600 |
| 201 | Ga0466704_332579 | 3300042643 | Bacteria | 76527 |
| 202 | Ga0466708_108618 | 3300042652 | Bacteria | 24572 |
| 203 | Ga0123356_10356392 | 3300010049 | Bacteria | 1588 |
| 204 | Ga0123353_10560183 | 3300010167 | Bacteria | 1646 |
| 205 | Ga0123353_10916292 | 3300010167 | Bacteria | 1191 |
| 206 | Ga0466719_031516 | 3300042606 | Bacteria | 3325 |
| 207 | Ga0466719_441370 | 3300042606 | Bacteria | 11629 |
| 208 | Ga0466711_306824 | 3300042615 | Bacteria | 5217 |
| 209 | Ga0466726_039698 | 3300042619 | Unclassified | 1058 |
| 210 | Ga0466726_332183 | 3300042619 | Bacteria | 1992 |
| 211 | Ga0466728_308992 | 3300042620 | Unclassified | 1828 |
| 212 | Ga0466705_357981 | 3300042612 | Unclassified | 4893 |
| 213 | Ga0466733_022928 | 3300042659 | Bacteria | 2628 |
| 214 | Ga0466692_002352 | 3300042591 | Bacteria | 7304 |
| 215 | Ga0466694_063966 | 3300042594 | Bacteria | 1242 |
| 216 | Ga0466696_014693 | 3300042596 | Bacteria | 1270 |
| 217 | Ga0466696_164169 | 3300042596 | Bacteria | 1049 |
| 218 | JGI24695J34938_10031185 | 3300002450 | Bacteria | 2476 |
| 219 | Ga0068302_10094067 | 3300005071 | Bacteria | 608 |
| 220 | Ga0068305_10087800 | 3300005083 | Bacteria | 3279 |
| 221 | Ga0072941_1063684 | 3300005201 | Bacteria | 1566 |
| 222 | Ga0123357_10003185 | 3300009784 | Bacteria | 18677 |
| 223 | Ga0466729_214857 | 3300042621 | Bacteria | 1112 |
| 224 | Ga0466729_296295 | 3300042621 | Bacteria | 2114 |
| 225 | Ga0466731_096760 | 3300042622 | Unclassified | 2416 |
| 226 | Ga0466702_137969 | 3300042635 | Bacteria | 1785 |
| 227 | Ga0466709_366945 | 3300042648 | Bacteria | 3009 |
| 228 | Ga0123355_10797445 | 3300009826 | Unclassified | 1054 |
| 229 | Ga0123353_10254607 | 3300010167 | Bacteria | 2716 |
| 230 | Ga0123353_10391699 | 3300010167 | Unclassified | 2072 |
| 231 | Ga0123354_10052133 | 3300010882 | Bacteria | 6167 |
| 232 | Ga0466719_334370 | 3300042606 | Bacteria | 2046 |
| 233 | Ga0466722_029785 | 3300042609 | Bacteria | 10359 |
| 234 | Ga0466698_243055 | 3300042610 | Bacteria | 4916 |
| 235 | Ga0466698_264407 | 3300042610 | Bacteria | 1389 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01632 | Ribosomal_L35p | Ribosomal protein L35 | 6 | 65 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.