Protein Family IF09177
Metagenome
Isolate
184
Members
45
Samples
178
Scaffolds
195.79
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_178109|Ga0466703_178109_730_1401
- Length
- 223 aa
- Sequence
- VVYPAGKLTETGVTGYTFFMSEPEKNLTREAAWDLLKTYNKDPFHLQHGLTVEGVMRWYARDLGYGAEEDFWGVVGLLHDIDFELYPDQHCIKAPELLRAAGAGEALIRGVCSHGYELTVEVKPEHPMEKVLYGADELTGLIWAAAIIRPSKSVQDLELKSVKKKYKAANFAAGCSREVIQKGAAMLGWDLDTLIEKTILAMRSCEAAVNAFSAECASPGGTR
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
31.8%
Termitidae
31.8%
Unclassified
18.2%
Rhinotermitidae
9.1%
Termopsidae
6.8%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
173
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820921285 | Unclassified Actinobacteria Emb289P3bin53 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 30 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 31 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 43 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24695J34938_10027465 | 3300002450 | Bacteria | 2690 |
| 2 | Ga0072941_1004944 | 3300005201 | Bacteria | 8638 |
| 3 | Ga0072941_1015825 | 3300005201 | Bacteria | 7566 |
| 4 | Ga0466712_036098 | 3300042614 | Bacteria | 1375 |
| 5 | Ga0466715_316435 | 3300042616 | Bacteria | 2771 |
| 6 | Ga0466728_002302 | 3300042620 | Bacteria | 1814 |
| 7 | Ga0466729_080914 | 3300042621 | Bacteria | 1228 |
| 8 | Ga0123356_10945475 | 3300010049 | Bacteria | 1033 |
| 9 | Ga0123353_10123034 | 3300010167 | Bacteria | 4170 |
| 10 | Ga0466716_041186 | 3300042605 | Bacteria | 35311 |
| 11 | Ga0466716_529754 | 3300042605 | Bacteria | 7753 |
| 12 | Ga0466719_004254 | 3300042606 | Unclassified | 1531 |
| 13 | Ga0466719_081687 | 3300042606 | Bacteria | 3157 |
| 14 | Ga0466721_338913 | 3300042608 | Bacteria | 3102 |
| 15 | Ga0466722_037252 | 3300042609 | Bacteria | 3187 |
| 16 | Ga0466722_215161 | 3300042609 | Bacteria | 9486 |
| 17 | Ga0466690_075681 | 3300042590 | Bacteria | 1867 |
| 18 | Ga0466693_137434 | 3300042592 | Bacteria | 55598 |
| 19 | Ga0466694_205814 | 3300042594 | Bacteria | 1247 |
| 20 | Ga0466703_103665 | 3300042636 | Bacteria | 2498 |
| 21 | Ga0466703_178109 | 3300042636 | Bacteria | 4010 |
| 22 | Ga0466704_249234 | 3300042643 | Bacteria | 26787 |
| 23 | Ga0466709_164507 | 3300042648 | Bacteria | 3970 |
| 24 | Ga0466708_242308 | 3300042652 | Bacteria | 14613 |
| 25 | Ga0466708_289913 | 3300042652 | Bacteria | 4933 |
| 26 | Ga0466708_309842 | 3300042652 | Bacteria | 3657 |
| 27 | JGI24698J34947_10084896 | 3300002449 | Bacteria | 1473 |
| 28 | Ga0466705_524490 | 3300042612 | Bacteria | 2085 |
| 29 | Ga0466723_143970 | 3300042618 | Bacteria | 33072 |
| 30 | Ga0466723_177131 | 3300042618 | Bacteria | 14114 |
| 31 | Ga0466728_063650 | 3300042620 | Bacteria | 1436 |
| 32 | Ga0466728_104752 | 3300042620 | Bacteria | 2294 |
| 33 | Ga0466728_363789 | 3300042620 | Bacteria | 3671 |
| 34 | Ga0123356_10038992 | 3300010049 | Bacteria | 4426 |
| 35 | Ga0466707_113007 | 3300042601 | Bacteria | 1544 |
| 36 | Ga0466707_242708 | 3300042601 | Bacteria | 1609 |
| 37 | Ga0466707_421703 | 3300042601 | Bacteria | 1985 |
| 38 | Ga0466716_043537 | 3300042605 | Bacteria | 14034 |
| 39 | Ga0466716_284036 | 3300042605 | Bacteria | 4045 |
| 40 | Ga0466719_390261 | 3300042606 | Bacteria | 1044 |
| 41 | Ga0466719_520050 | 3300042606 | Bacteria | 1920 |
| 42 | Ga0466722_100611 | 3300042609 | Bacteria | 6408 |
| 43 | Ga0466692_202639 | 3300042591 | Bacteria | 1312 |
| 44 | Ga0466691_100918 | 3300042593 | Bacteria | 15048 |
| 45 | Ga0466735_235868 | 3300042624 | Bacteria | 7251 |
| 46 | Ga0466703_118347 | 3300042636 | Bacteria | 13052 |
| 47 | AustNasuHG_c1002342 | 3300000089 | Bacteria | 6846 |
| 48 | Ga0072940_1474155 | 3300005200 | Bacteria | 1149 |
| 49 | Ga0466715_000089 | 3300042616 | Unclassified | 1327 |
| 50 | Ga0466715_230123 | 3300042616 | Bacteria | 5605 |
| 51 | Ga0466715_479896 | 3300042616 | Bacteria | 9458 |
| 52 | Ga0466723_116980 | 3300042618 | Bacteria | 2283 |
| 53 | Ga0466723_118317 | 3300042618 | Unclassified | 3786 |
| 54 | Ga0466723_130141 | 3300042618 | Bacteria | 92926 |
| 55 | Ga0466726_151536 | 3300042619 | Bacteria | 2720 |
| 56 | Ga0466726_362614 | 3300042619 | Bacteria | 3223 |
| 57 | Ga0466733_205075 | 3300042659 | Bacteria | 1076 |
| 58 | Ga0466716_422819 | 3300042605 | Bacteria | 3002 |
| 59 | Ga0466719_199354 | 3300042606 | Bacteria | 4473 |
| 60 | Ga0466690_204017 | 3300042590 | Bacteria | 3407 |
| 61 | Ga0466691_010871 | 3300042593 | Bacteria | 49888 |
| 62 | Ga0466691_050211 | 3300042593 | Bacteria | 6464 |
| 63 | Ga0466735_190845 | 3300042624 | Bacteria | 1025 |
| 64 | Ga0466703_280209 | 3300042636 | Bacteria | 13282 |
| 65 | Ga0466704_063793 | 3300042643 | Bacteria | 10978 |
| 66 | Ga0466704_392445 | 3300042643 | Bacteria | 1270 |
| 67 | Ga0466704_533154 | 3300042643 | Bacteria | 2027 |
| 68 | Ga0466704_551125 | 3300042643 | Bacteria | 2370 |
| 69 | Ga0466709_207959 | 3300042648 | Unclassified | 4207 |
| 70 | Ga0466708_395971 | 3300042652 | Bacteria | 9045 |
| 71 | Ga0466708_459716 | 3300042652 | Bacteria | 7202 |
| 72 | AustNasuHG_c1013361 | 3300000089 | Bacteria | 2817 |
| 73 | Ga0466715_359291 | 3300042616 | Bacteria | 2324 |
| 74 | Ga0466705_112913 | 3300042612 | Bacteria | 17483 |
| 75 | Ga0466705_211961 | 3300042612 | Bacteria | 3570 |
| 76 | Ga0466706_087354 | 3300042599 | Bacteria | 1657 |
| 77 | Ga0466719_445028 | 3300042606 | Bacteria | 1094 |
| 78 | Ga0466722_237038 | 3300042609 | Bacteria | 9962 |
| 79 | Ga0466692_194294 | 3300042591 | Bacteria | 5146 |
| 80 | Ga0466691_026220 | 3300042593 | Bacteria | 3578 |
| 81 | Ga0466696_072579 | 3300042596 | Bacteria | 12290 |
| 82 | Ga0466735_001413 | 3300042624 | Bacteria | 2895 |
| 83 | Ga0466703_136432 | 3300042636 | Bacteria | 5278 |
| 84 | Ga0466703_200348 | 3300042636 | Bacteria | 25667 |
| 85 | Ga0466704_097021 | 3300042643 | Unclassified | 5124 |
| 86 | Ga0466704_102095 | 3300042643 | Bacteria | 16074 |
| 87 | Ga0466709_091864 | 3300042648 | Bacteria | 28785 |
| 88 | Ga0466708_038995 | 3300042652 | Bacteria | 14766 |
| 89 | Ga0466708_124302 | 3300042652 | Bacteria | 47506 |
| 90 | JGI24698J34947_10088627 | 3300002449 | Bacteria | 1427 |
| 91 | Ga0072941_1004990 | 3300005201 | Bacteria | 11075 |
| 92 | Ga0466711_431493 | 3300042615 | Bacteria | 2234 |
| 93 | Ga0466711_490656 | 3300042615 | Bacteria | 7358 |
| 94 | Ga0466715_037209 | 3300042616 | Bacteria | 3161 |
| 95 | Ga0466715_038586 | 3300042616 | Bacteria | 3195 |
| 96 | Ga0466715_068582 | 3300042616 | Bacteria | 2213 |
| 97 | Ga0466715_532389 | 3300042616 | Bacteria | 3127 |
| 98 | Ga0466723_339916 | 3300042618 | Bacteria | 7288 |
| 99 | Ga0466726_368090 | 3300042619 | Bacteria | 1525 |
| 100 | Ga0466728_135350 | 3300042620 | Bacteria | 12448 |
| 101 | Ga0466728_456724 | 3300042620 | Bacteria | 2489 |
| 102 | Ga0123353_10802031 | 3300010167 | Bacteria | 1300 |
| 103 | Ga0466707_006951 | 3300042601 | Bacteria | 1040 |
| 104 | Ga0466707_381485 | 3300042601 | Bacteria | 1509 |
| 105 | Ga0466719_056084 | 3300042606 | Bacteria | 1622 |
| 106 | Ga0466722_163662 | 3300042609 | Bacteria | 1585 |
| 107 | Ga0456237_0009919 | 3300041968 | Bacteria | 1412 |
| 108 | Ga0466690_117561 | 3300042590 | Bacteria | 2003 |
| 109 | Ga0466690_128014 | 3300042590 | Bacteria | 6255 |
| 110 | Ga0466692_120409 | 3300042591 | Bacteria | 5032 |
| 111 | Ga0466703_044929 | 3300042636 | Bacteria | 13994 |
| 112 | Ga0466703_263961 | 3300042636 | Unclassified | 2470 |
| 113 | Ga0466709_161757 | 3300042648 | Bacteria | 27099 |
| 114 | Ga0466709_214721 | 3300042648 | Bacteria | 2988 |
| 115 | Ga0466709_294400 | 3300042648 | Bacteria | 1277 |
| 116 | Ga0466727_080996 | 3300042655 | Bacteria | 1543 |
| 117 | Ga0466715_494677 | 3300042616 | Bacteria | 7195 |
| 118 | Ga0466705_019210 | 3300042612 | Bacteria | 14899 |
| 119 | Ga0466705_159045 | 3300042612 | Bacteria | 1255 |
| 120 | Ga0466707_104045 | 3300042601 | Bacteria | 1307 |
| 121 | Ga0466713_104318 | 3300042602 | Bacteria | 6688 |
| 122 | Ga0466719_356432 | 3300042606 | Bacteria | 1759 |
| 123 | Ga0466722_059203 | 3300042609 | Bacteria | 3554 |
| 124 | Ga0466690_000701 | 3300042590 | Bacteria | 1656 |
| 125 | Ga0466692_178806 | 3300042591 | Bacteria | 32596 |
| 126 | Ga0466691_066686 | 3300042593 | Unclassified | 1408 |
| 127 | Ga0466691_195610 | 3300042593 | Bacteria | 14052 |
| 128 | Ga0466729_206256 | 3300042621 | Bacteria | 13126 |
| 129 | Ga0466729_236180 | 3300042621 | Bacteria | 2697 |
| 130 | Ga0466704_275245 | 3300042643 | Bacteria | 5369 |
| 131 | Ga0466708_272748 | 3300042652 | Bacteria | 4904 |
| 132 | Ga0466715_428033 | 3300042616 | Bacteria | 3624 |
| 133 | Ga0466723_105429 | 3300042618 | Bacteria | 2815 |
| 134 | Ga0466723_283019 | 3300042618 | Unclassified | 1250 |
| 135 | Ga0466728_347227 | 3300042620 | Bacteria | 1004 |
| 136 | Ga0466705_380158 | 3300042612 | Bacteria | 3624 |
| 137 | Ga0123355_10228558 | 3300009826 | Bacteria | 2661 |
| 138 | Ga0123356_10393865 | 3300010049 | Bacteria | 1521 |
| 139 | Ga0466707_146104 | 3300042601 | Bacteria | 4059 |
| 140 | Ga0466716_019536 | 3300042605 | Bacteria | 5356 |
| 141 | Ga0466719_041733 | 3300042606 | Bacteria | 9409 |
| 142 | Ga0466719_204086 | 3300042606 | Bacteria | 20417 |
| 143 | Ga0466719_337577 | 3300042606 | Bacteria | 1217 |
| 144 | Ga0466722_007157 | 3300042609 | Bacteria | 1641 |
| 145 | Ga0466722_012977 | 3300042609 | Unclassified | 3326 |
| 146 | Ga0466722_155244 | 3300042609 | Bacteria | 4393 |
| 147 | Ga0466722_202151 | 3300042609 | Bacteria | 9086 |
| 148 | Ga0466690_037396 | 3300042590 | Bacteria | 1788 |
| 149 | Ga0466692_048021 | 3300042591 | Bacteria | 6842 |
| 150 | Ga0466691_067224 | 3300042593 | Bacteria | 1394 |
| 151 | Ga0466691_104877 | 3300042593 | Bacteria | 2983 |
| 152 | Ga0466696_438039 | 3300042596 | Bacteria | 2225 |
| 153 | Ga0466709_038229 | 3300042648 | Unclassified | 1443 |
| 154 | Ga0466727_326471 | 3300042655 | Bacteria | 2431 |
| 155 | Ga0074263_116941 | 3300005485 | Bacteria | 1014 |
| 156 | Ga0466705_408170 | 3300042612 | Bacteria | 28126 |
| 157 | Ga0466705_494194 | 3300042612 | Bacteria | 1197 |
| 158 | Ga0466711_107671 | 3300042615 | Bacteria | 3672 |
| 159 | Ga0466711_223970 | 3300042615 | Bacteria | 2529 |
| 160 | Ga0466711_233853 | 3300042615 | Bacteria | 2176 |
| 161 | Ga0466715_175443 | 3300042616 | Bacteria | 2438 |
| 162 | Ga0466715_613697 | 3300042616 | Bacteria | 2937 |
| 163 | Ga0466723_053148 | 3300042618 | Bacteria | 5638 |
| 164 | Ga0466723_102363 | 3300042618 | Unclassified | 3392 |
| 165 | Ga0466726_166119 | 3300042619 | Bacteria | 6472 |
| 166 | Ga0466726_269985 | 3300042619 | Bacteria | 2362 |
| 167 | Ga0466726_397953 | 3300042619 | Bacteria | 6281 |
| 168 | Ga0123353_10443766 | 3300010167 | Bacteria | 1913 |
| 169 | Ga0466717_096169 | 3300042604 | Bacteria | 1639 |
| 170 | Ga0466716_182760 | 3300042605 | Bacteria | 5213 |
| 171 | Ga0466692_105793 | 3300042591 | Bacteria | 12711 |
| 172 | Ga0466696_374210 | 3300042596 | Bacteria | 1134 |
| 173 | Ga0466704_264627 | 3300042643 | Bacteria | 11031 |
| 174 | Ga0466709_255556 | 3300042648 | Bacteria | 2792 |
| 175 | Ga0466709_292242 | 3300042648 | Bacteria | 5598 |
| 176 | Ga0466708_159740 | 3300042652 | Bacteria | 2874 |
| 177 | Ga0466708_265074 | 3300042652 | Bacteria | 1007 |
| 178 | Ga0466727_266819 | 3300042655 | Bacteria | 1317 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.