Protein Family IF09168
Metagenome
Isolate
243
Members
85
Samples
201
Scaffolds
254.63
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_164508|Ga0466703_164508_214_1077
- Length
- 287 aa
- Sequence
- MAGRAVWQAFGRAAGERGSDGGRRNDGGHMISIKTGREIDLMRRAGDILARCVLMLEQNVADGVVTSELDRLAAEFMRKHNAIASFFGVPGMVDGAPGFPASVCVSVNDEVIHGIPGGRRIKDGDIVSVDMGAIYMGYHSDMARTFCVGAVPEEAARLVRVTMESFYEGMLGAAPGNRISDISRRVQAHAEAAGYSVVRDFVGHGIGTEMHEPPQIPNFVTRGERGARLAAGMTLAIEPMVNAGAPDIDILPNKWTVATRDRSLSAHYENTILVVADGQAEILSAPA
Sample Types
Isolate
17.3%
Metagenome
82.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.3%
Termitidae
21.4%
Kalotermitidae
15.5%
Blattidae
11.9%
Apidae
4.8%
Termopsidae
4.8%
Rhinotermitidae
3.6%
Stratiomyidae
1.2%
Noctuidae
1.2%
Passalidae
1.2%
Hodotermitidae
1.2%
Taxonomy
Archaea
0
Bacteria
240
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 2 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 3 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 4 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 5 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 6 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 7 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 8 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 9 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 10 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 11 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 18 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 19 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 20 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 21 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 22 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 26 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 27 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 28 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 29 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 36 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 37 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 38 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 39 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 40 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 41 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 48 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 49 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 50 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 51 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 54 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 55 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 59 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 60 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 61 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 62 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 63 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 64 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 65 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 66 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 67 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 68 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 69 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 70 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 71 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 72 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 73 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 74 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 75 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 76 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 77 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 78 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 79 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 80 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 81 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 82 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 83 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 84 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 85 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24705J35276_12238163 | 3300002504 | Bacteria | 16705 |
| 2 | Ga0068305_10001287 | 3300005083 | Bacteria | 40663 |
| 3 | Ga0068305_10001382 | 3300005083 | Bacteria | 35132 |
| 4 | Ga0466697_134872 | 3300042611 | Bacteria | 5929 |
| 5 | Ga0466705_079320 | 3300042612 | Bacteria | 80574 |
| 6 | Ga0466705_304963 | 3300042612 | Bacteria | 11876 |
| 7 | Ga0466735_033778 | 3300042624 | Bacteria | 18285 |
| 8 | Ga0466735_052919 | 3300042624 | Bacteria | 17118 |
| 9 | Ga0466735_068093 | 3300042624 | Bacteria | 16099 |
| 10 | Ga0466735_176248 | 3300042624 | Bacteria | 15805 |
| 11 | Ga0466704_121419 | 3300042643 | Bacteria | 8439 |
| 12 | Ga0466727_271147 | 3300042655 | Bacteria | 176023 |
| 13 | Ga0466711_085016 | 3300042615 | Bacteria | 50472 |
| 14 | Ga0466715_257161 | 3300042616 | Bacteria | 85931 |
| 15 | Ga0466715_436492 | 3300042616 | Bacteria | 169505 |
| 16 | Ga0466723_259791 | 3300042618 | Bacteria | 1352 |
| 17 | Ga0466723_259805 | 3300042618 | Bacteria | 11102 |
| 18 | Ga0466726_020553 | 3300042619 | Bacteria | 11602 |
| 19 | Ga0466726_423141 | 3300042619 | Bacteria | 2503 |
| 20 | Ga0466726_435536 | 3300042619 | Bacteria | 8048 |
| 21 | Ga0466694_207338 | 3300042594 | Bacteria | 4989 |
| 22 | Ga0123357_10197809 | 3300009784 | Bacteria | 2297 |
| 23 | Ga0123355_10024702 | 3300009826 | Bacteria | 9662 |
| 24 | Ga0123353_10000161 | 3300010167 | Bacteria | 85161 |
| 25 | Ga0123353_10161654 | 3300010167 | Bacteria | 3565 |
| 26 | Ga0123354_10052153 | 3300010882 | Bacteria | 6165 |
| 27 | Ga0466707_063131 | 3300042601 | Bacteria | 29958 |
| 28 | Ga0466713_104587 | 3300042602 | Bacteria | 60209 |
| 29 | JGI24702J35022_10031983 | 3300002462 | Bacteria | 2818 |
| 30 | JGI24705J35276_12221469 | 3300002504 | Bacteria | 2343 |
| 31 | Ga0466735_001254 | 3300042624 | Bacteria | 21222 |
| 32 | Ga0466735_164481 | 3300042624 | Bacteria | 11213 |
| 33 | Ga0466735_218123 | 3300042624 | Bacteria | 14066 |
| 34 | Ga0466703_195067 | 3300042636 | Bacteria | 1452 |
| 35 | Ga0466727_059455 | 3300042655 | Bacteria | 175715 |
| 36 | Ga0466729_026885 | 3300042621 | Bacteria | 13644 |
| 37 | Ga0466729_049621 | 3300042621 | Bacteria | 3202 |
| 38 | Ga0415639_142988 | 3300038395 | Bacteria | 1277 |
| 39 | Ga0123355_10203759 | 3300009826 | Unclassified | 2884 |
| 40 | Ga0123356_10003243 | 3300010049 | Bacteria | 17093 |
| 41 | Ga0123356_10277246 | 3300010049 | Bacteria | 1770 |
| 42 | Ga0123356_10775499 | 3300010049 | Bacteria | 1129 |
| 43 | Ga0123353_10296882 | 3300010167 | Bacteria | 2470 |
| 44 | Ga0466706_050675 | 3300042599 | Bacteria | 29028 |
| 45 | Ga0466707_253816 | 3300042601 | Bacteria | 1044 |
| 46 | Ga0466707_315151 | 3300042601 | Bacteria | 79442 |
| 47 | Ga0466714_088412 | 3300042603 | Bacteria | 38937 |
| 48 | Ga0466716_112946 | 3300042605 | Bacteria | 4427 |
| 49 | Ga0466716_287106 | 3300042605 | Bacteria | 4411 |
| 50 | Ga0466719_480607 | 3300042606 | Bacteria | 2358 |
| 51 | JGI24702J35022_10000742 | 3300002462 | Bacteria | 20088 |
| 52 | Ga0068305_10000079 | 3300005083 | Bacteria | 163717 |
| 53 | Ga0466703_194575 | 3300042636 | Bacteria | 7445 |
| 54 | Ga0466725_349006 | 3300042654 | Bacteria | 2235 |
| 55 | Ga0466705_392104 | 3300042612 | Bacteria | 17200 |
| 56 | Ga0466711_193757 | 3300042615 | Bacteria | 1693 |
| 57 | Ga0466723_218982 | 3300042618 | Bacteria | 2283 |
| 58 | Ga0466726_342920 | 3300042619 | Bacteria | 1448 |
| 59 | Ga0466729_129641 | 3300042621 | Bacteria | 24606 |
| 60 | Ga0415639_127326 | 3300038395 | Unclassified | 1350 |
| 61 | Ga0123355_10130320 | 3300009826 | Bacteria | 3876 |
| 62 | Ga0123356_10055309 | 3300010049 | Bacteria | 3696 |
| 63 | Ga0123356_10283612 | 3300010049 | Bacteria | 1753 |
| 64 | Ga0123356_11505805 | 3300010049 | Bacteria | 830 |
| 65 | Ga0123353_10020136 | 3300010167 | Bacteria | 9950 |
| 66 | Ga0123353_10341228 | 3300010167 | Bacteria | 2262 |
| 67 | Ga0466707_234948 | 3300042601 | Bacteria | 79283 |
| 68 | Ga0466713_059453 | 3300042602 | Bacteria | 25190 |
| 69 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 70 | Ga0466721_284692 | 3300042608 | Bacteria | 4701 |
| 71 | Ga0466722_259279 | 3300042609 | Bacteria | 4594 |
| 72 | Ga0466705_211599 | 3300042612 | Bacteria | 21797 |
| 73 | Ga0466735_008299 | 3300042624 | Bacteria | 6183 |
| 74 | Ga0466735_201674 | 3300042624 | Bacteria | 26620 |
| 75 | Ga0466703_164508 | 3300042636 | Bacteria | 2976 |
| 76 | Ga0466703_190986 | 3300042636 | Bacteria | 2102 |
| 77 | Ga0466703_360640 | 3300042636 | Bacteria | 6191 |
| 78 | Ga0466704_404784 | 3300042643 | Bacteria | 19036 |
| 79 | Ga0466724_50901 | 3300042649 | Bacteria | 4011 |
| 80 | Ga0466708_053951 | 3300042652 | Bacteria | 19818 |
| 81 | Ga0466708_079679 | 3300042652 | Bacteria | 41277 |
| 82 | Ga0466723_345366 | 3300042618 | Bacteria | 19928 |
| 83 | Ga0466729_117205 | 3300042621 | Bacteria | 50557 |
| 84 | Ga0466656_385658 | 3300042550 | Bacteria | 2440 |
| 85 | Ga0466696_252112 | 3300042596 | Bacteria | 2768 |
| 86 | Ga0466696_300257 | 3300042596 | Bacteria | 1223 |
| 87 | Ga0123357_10013005 | 3300009784 | Bacteria | 10764 |
| 88 | Ga0123355_10361429 | 3300009826 | Bacteria | 1912 |
| 89 | Ga0123356_10000134 | 3300010049 | Bacteria | 82554 |
| 90 | Ga0123356_10007080 | 3300010049 | Bacteria | 11238 |
| 91 | Ga0123356_10040250 | 3300010049 | Bacteria | 4355 |
| 92 | Ga0123356_10156577 | 3300010049 | Bacteria | 2270 |
| 93 | Ga0123356_10229743 | 3300010049 | Bacteria | 1919 |
| 94 | Ga0123356_10245587 | 3300010049 | Bacteria | 1864 |
| 95 | Ga0123353_10011361 | 3300010167 | Bacteria | 12538 |
| 96 | Ga0123353_10025626 | 3300010167 | Bacteria | 8990 |
| 97 | Ga0123353_10379484 | 3300010167 | Bacteria | 2115 |
| 98 | Ga0123354_10002502 | 3300010882 | Bacteria | 24370 |
| 99 | Ga0466706_020366 | 3300042599 | Bacteria | 2655 |
| 100 | Ga0466722_005776 | 3300042609 | Bacteria | 2210 |
| 101 | IMNBL1DRAFT_c0024307 | 3300000062 | Bacteria | 2352 |
| 102 | Ga0466705_365823 | 3300042612 | Bacteria | 22090 |
| 103 | Ga0466703_203929 | 3300042636 | Bacteria | 4723 |
| 104 | Ga0466715_043804 | 3300042616 | Bacteria | 8517 |
| 105 | Ga0466715_116646 | 3300042616 | Bacteria | 13720 |
| 106 | Ga0466715_140298 | 3300042616 | Bacteria | 1177 |
| 107 | Ga0466715_330755 | 3300042616 | Bacteria | 2054 |
| 108 | Ga0466729_155158 | 3300042621 | Bacteria | 5707 |
| 109 | Ga0466691_192340 | 3300042593 | Bacteria | 1041 |
| 110 | Ga0123357_10004444 | 3300009784 | Bacteria | 16465 |
| 111 | Ga0123357_10006163 | 3300009784 | Bacteria | 14543 |
| 112 | Ga0123355_10002506 | 3300009826 | Bacteria | 26020 |
| 113 | Ga0123355_10005323 | 3300009826 | Bacteria | 18809 |
| 114 | Ga0123355_10070886 | 3300009826 | Bacteria | 5596 |
| 115 | Ga0123355_10404777 | 3300009826 | Bacteria | 1757 |
| 116 | Ga0123356_10494630 | 3300010049 | Bacteria | 1378 |
| 117 | Ga0123353_10130818 | 3300010167 | Bacteria | 4027 |
| 118 | Ga0123354_10252186 | 3300010882 | Bacteria | 1784 |
| 119 | Ga0466733_033791 | 3300042659 | Bacteria | 1015 |
| 120 | Ga0466707_012192 | 3300042601 | Bacteria | 7479 |
| 121 | Ga0466707_322026 | 3300042601 | Bacteria | 13036 |
| 122 | Ga0466707_413321 | 3300042601 | Bacteria | 5124 |
| 123 | Ga0466713_092327 | 3300042602 | Bacteria | 48279 |
| 124 | Ga0466713_155303 | 3300042602 | Bacteria | 17735 |
| 125 | Ga0466734_057233 | 3300042623 | Bacteria | 1227 |
| 126 | Ga0466735_070774 | 3300042624 | Bacteria | 15100 |
| 127 | Ga0466735_176291 | 3300042624 | Bacteria | 2512 |
| 128 | Ga0466735_194848 | 3300042624 | Bacteria | 5945 |
| 129 | Ga0466704_011432 | 3300042643 | Bacteria | 3802 |
| 130 | Ga0466704_116481 | 3300042643 | Bacteria | 45712 |
| 131 | Ga0466709_009067 | 3300042648 | Bacteria | 2740 |
| 132 | Ga0466727_171524 | 3300042655 | Bacteria | 3228 |
| 133 | Ga0466711_355509 | 3300042615 | Bacteria | 12832 |
| 134 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 135 | Ga0466711_488791 | 3300042615 | Bacteria | 1451 |
| 136 | Ga0466715_643287 | 3300042616 | Bacteria | 2289 |
| 137 | Ga0466692_138200 | 3300042591 | Bacteria | 4068 |
| 138 | Ga0123355_10000171 | 3300009826 | Bacteria | 79083 |
| 139 | Ga0123355_10118098 | 3300009826 | Bacteria | 4122 |
| 140 | Ga0123356_10000157 | 3300010049 | Bacteria | 76908 |
| 141 | Ga0123356_10091638 | 3300010049 | Bacteria | 2897 |
| 142 | Ga0123356_10209381 | 3300010049 | Bacteria | 1997 |
| 143 | Ga0123356_10308670 | 3300010049 | Bacteria | 1690 |
| 144 | Ga0123353_10008575 | 3300010167 | Bacteria | 13986 |
| 145 | Ga0123353_10122215 | 3300010167 | Bacteria | 4185 |
| 146 | Ga0123353_10323878 | 3300010167 | Bacteria | 2337 |
| 147 | Ga0123353_11210651 | 3300010167 | Bacteria | 990 |
| 148 | Ga0466716_470771 | 3300042605 | Bacteria | 2675 |
| 149 | Ga0466719_173332 | 3300042606 | Bacteria | 2834 |
| 150 | Ga0466719_287038 | 3300042606 | Bacteria | 1088 |
| 151 | IMNBL1DRAFT_c0010323 | 3300000062 | Bacteria | 4493 |
| 152 | Ga0466735_050544 | 3300042624 | Bacteria | 5700 |
| 153 | Ga0466735_146156 | 3300042624 | Bacteria | 2781 |
| 154 | Ga0466704_031146 | 3300042643 | Bacteria | 38318 |
| 155 | Ga0466727_263039 | 3300042655 | Bacteria | 14042 |
| 156 | Ga0466715_051700 | 3300042616 | Bacteria | 2899 |
| 157 | Ga0466726_228652 | 3300042619 | Bacteria | 2681 |
| 158 | Ga0466728_082463 | 3300042620 | Bacteria | 32980 |
| 159 | Ga0415639_095664 | 3300038395 | Bacteria | 1596 |
| 160 | Ga0466692_130735 | 3300042591 | Bacteria | 26218 |
| 161 | Ga0466691_140188 | 3300042593 | Bacteria | 4047 |
| 162 | Ga0123355_10092527 | 3300009826 | Bacteria | 4789 |
| 163 | Ga0123355_10095583 | 3300009826 | Bacteria | 4695 |
| 164 | Ga0123355_10115160 | 3300009826 | Bacteria | 4188 |
| 165 | Ga0123356_10068223 | 3300010049 | Bacteria | 3331 |
| 166 | Ga0123356_10208379 | 3300010049 | Bacteria | 2001 |
| 167 | Ga0123356_10285799 | 3300010049 | Bacteria | 1747 |
| 168 | Ga0123353_10008697 | 3300010167 | Bacteria | 13893 |
| 169 | Ga0123353_10013104 | 3300010167 | Bacteria | 11852 |
| 170 | Ga0123353_10148074 | 3300010167 | Bacteria | 3752 |
| 171 | Ga0123353_10253219 | 3300010167 | Bacteria | 2725 |
| 172 | Ga0123353_10257379 | 3300010167 | Bacteria | 2699 |
| 173 | Ga0123353_10436325 | 3300010167 | Bacteria | 1934 |
| 174 | Ga0123353_10488280 | 3300010167 | Unclassified | 1799 |
| 175 | Ga0123353_10672929 | 3300010167 | Bacteria | 1460 |
| 176 | Ga0123353_10957340 | 3300010167 | Bacteria | 1157 |
| 177 | Ga0466706_166478 | 3300042599 | Bacteria | 103376 |
| 178 | JGI24702J35022_10034844 | 3300002462 | Bacteria | 2692 |
| 179 | Ga0068302_10001564 | 3300005071 | Bacteria | 20938 |
| 180 | Ga0466705_357809 | 3300042612 | Bacteria | 37083 |
| 181 | Ga0466735_053051 | 3300042624 | Bacteria | 11352 |
| 182 | Ga0466735_172430 | 3300042624 | Bacteria | 13043 |
| 183 | Ga0466704_375586 | 3300042643 | Bacteria | 37503 |
| 184 | Ga0466727_214209 | 3300042655 | Bacteria | 66628 |
| 185 | Ga0466711_300045 | 3300042615 | Bacteria | 6202 |
| 186 | Ga0466728_219928 | 3300042620 | Bacteria | 3500 |
| 187 | Ga0466728_250120 | 3300042620 | Bacteria | 1710 |
| 188 | Ga0264413_157352 | 3300024493 | Bacteria | 1982 |
| 189 | Ga0415639_119459 | 3300038395 | Bacteria | 1551 |
| 190 | Ga0466696_265464 | 3300042596 | Bacteria | 21014 |
| 191 | Ga0123355_10026081 | 3300009826 | Bacteria | 9422 |
| 192 | Ga0123355_10124998 | 3300009826 | Bacteria | 3977 |
| 193 | Ga0123356_10056569 | 3300010049 | Bacteria | 3655 |
| 194 | Ga0123356_10167745 | 3300010049 | Bacteria | 2202 |
| 195 | Ga0123356_10202245 | 3300010049 | Bacteria | 2027 |
| 196 | Ga0123356_10247837 | 3300010049 | Bacteria | 1857 |
| 197 | Ga0123356_10663955 | 3300010049 | Bacteria | 1210 |
| 198 | Ga0123356_11162781 | 3300010049 | Bacteria | 939 |
| 199 | Ga0123353_10164135 | 3300010167 | Bacteria | 3533 |
| 200 | Ga0123353_11543639 | 3300010167 | Bacteria | 843 |
| 201 | Ga0123354_10217085 | 3300010882 | Bacteria | 2046 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00557 | Peptidase_M24 | Metallopeptidase family M24 | 41 | 275 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.