Protein Family IF09168

Metagenome Isolate
243 Members
85 Samples
201 Scaffolds
254.63 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_164508|Ga0466703_164508_214_1077
Length
287 aa
Sequence
MAGRAVWQAFGRAAGERGSDGGRRNDGGHMISIKTGREIDLMRRAGDILARCVLMLEQNVADGVVTSELDRLAAEFMRKHNAIASFFGVPGMVDGAPGFPASVCVSVNDEVIHGIPGGRRIKDGDIVSVDMGAIYMGYHSDMARTFCVGAVPEEAARLVRVTMESFYEGMLGAAPGNRISDISRRVQAHAEAAGYSVVRDFVGHGIGTEMHEPPQIPNFVTRGERGARLAAGMTLAIEPMVNAGAPDIDILPNKWTVATRDRSLSAHYENTILVVADGQAEILSAPA

πŸ“Š Sample Types

Isolate 17.3%
Metagenome 82.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 33.3%
Termitidae 21.4%
Kalotermitidae 15.5%
Blattidae 11.9%
Apidae 4.8%
Termopsidae 4.8%
Rhinotermitidae 3.6%
Stratiomyidae 1.2%
Noctuidae 1.2%
Passalidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 240
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
2 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
3 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
4 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
5 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
6 642555172 Endomicrobium trichonymphae Rs-D17 Isolate Unclassified
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
9 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
10 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
11 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
12 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
16 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
17 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
18 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
19 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
20 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
21 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
22 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
26 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
27 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
28 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
29 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
35 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
36 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
37 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
38 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
39 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
40 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
41 2820183396 Unclassified Planctomycetes Lab288P3bin214 Isolate Unclassified
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
44 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
45 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
48 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
49 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
50 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
51 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
52 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
53 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
54 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
55 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
56 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
59 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
60 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
61 2772190889 Unclassified Elusimicrobia Cu122P5_bin43 Isolate Unclassified
62 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
63 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
64 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
65 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
66 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
67 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
68 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
69 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
70 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
71 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
72 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
73 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
74 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
75 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
76 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
77 2820594669 Unclassified Firmicutes Emb289P1bin61 Isolate Unclassified
78 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
79 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
80 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
81 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
82 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
83 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
84 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
85 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24705J35276_12238163 3300002504 Bacteria 16705
2 Ga0068305_10001287 3300005083 Bacteria 40663
3 Ga0068305_10001382 3300005083 Bacteria 35132
4 Ga0466697_134872 3300042611 Bacteria 5929
5 Ga0466705_079320 3300042612 Bacteria 80574
6 Ga0466705_304963 3300042612 Bacteria 11876
7 Ga0466735_033778 3300042624 Bacteria 18285
8 Ga0466735_052919 3300042624 Bacteria 17118
9 Ga0466735_068093 3300042624 Bacteria 16099
10 Ga0466735_176248 3300042624 Bacteria 15805
11 Ga0466704_121419 3300042643 Bacteria 8439
12 Ga0466727_271147 3300042655 Bacteria 176023
13 Ga0466711_085016 3300042615 Bacteria 50472
14 Ga0466715_257161 3300042616 Bacteria 85931
15 Ga0466715_436492 3300042616 Bacteria 169505
16 Ga0466723_259791 3300042618 Bacteria 1352
17 Ga0466723_259805 3300042618 Bacteria 11102
18 Ga0466726_020553 3300042619 Bacteria 11602
19 Ga0466726_423141 3300042619 Bacteria 2503
20 Ga0466726_435536 3300042619 Bacteria 8048
21 Ga0466694_207338 3300042594 Bacteria 4989
22 Ga0123357_10197809 3300009784 Bacteria 2297
23 Ga0123355_10024702 3300009826 Bacteria 9662
24 Ga0123353_10000161 3300010167 Bacteria 85161
25 Ga0123353_10161654 3300010167 Bacteria 3565
26 Ga0123354_10052153 3300010882 Bacteria 6165
27 Ga0466707_063131 3300042601 Bacteria 29958
28 Ga0466713_104587 3300042602 Bacteria 60209
29 JGI24702J35022_10031983 3300002462 Bacteria 2818
30 JGI24705J35276_12221469 3300002504 Bacteria 2343
31 Ga0466735_001254 3300042624 Bacteria 21222
32 Ga0466735_164481 3300042624 Bacteria 11213
33 Ga0466735_218123 3300042624 Bacteria 14066
34 Ga0466703_195067 3300042636 Bacteria 1452
35 Ga0466727_059455 3300042655 Bacteria 175715
36 Ga0466729_026885 3300042621 Bacteria 13644
37 Ga0466729_049621 3300042621 Bacteria 3202
38 Ga0415639_142988 3300038395 Bacteria 1277
39 Ga0123355_10203759 3300009826 Unclassified 2884
40 Ga0123356_10003243 3300010049 Bacteria 17093
41 Ga0123356_10277246 3300010049 Bacteria 1770
42 Ga0123356_10775499 3300010049 Bacteria 1129
43 Ga0123353_10296882 3300010167 Bacteria 2470
44 Ga0466706_050675 3300042599 Bacteria 29028
45 Ga0466707_253816 3300042601 Bacteria 1044
46 Ga0466707_315151 3300042601 Bacteria 79442
47 Ga0466714_088412 3300042603 Bacteria 38937
48 Ga0466716_112946 3300042605 Bacteria 4427
49 Ga0466716_287106 3300042605 Bacteria 4411
50 Ga0466719_480607 3300042606 Bacteria 2358
51 JGI24702J35022_10000742 3300002462 Bacteria 20088
52 Ga0068305_10000079 3300005083 Bacteria 163717
53 Ga0466703_194575 3300042636 Bacteria 7445
54 Ga0466725_349006 3300042654 Bacteria 2235
55 Ga0466705_392104 3300042612 Bacteria 17200
56 Ga0466711_193757 3300042615 Bacteria 1693
57 Ga0466723_218982 3300042618 Bacteria 2283
58 Ga0466726_342920 3300042619 Bacteria 1448
59 Ga0466729_129641 3300042621 Bacteria 24606
60 Ga0415639_127326 3300038395 Unclassified 1350
61 Ga0123355_10130320 3300009826 Bacteria 3876
62 Ga0123356_10055309 3300010049 Bacteria 3696
63 Ga0123356_10283612 3300010049 Bacteria 1753
64 Ga0123356_11505805 3300010049 Bacteria 830
65 Ga0123353_10020136 3300010167 Bacteria 9950
66 Ga0123353_10341228 3300010167 Bacteria 2262
67 Ga0466707_234948 3300042601 Bacteria 79283
68 Ga0466713_059453 3300042602 Bacteria 25190
69 Ga0466719_130653 3300042606 Bacteria 158630
70 Ga0466721_284692 3300042608 Bacteria 4701
71 Ga0466722_259279 3300042609 Bacteria 4594
72 Ga0466705_211599 3300042612 Bacteria 21797
73 Ga0466735_008299 3300042624 Bacteria 6183
74 Ga0466735_201674 3300042624 Bacteria 26620
75 Ga0466703_164508 3300042636 Bacteria 2976
76 Ga0466703_190986 3300042636 Bacteria 2102
77 Ga0466703_360640 3300042636 Bacteria 6191
78 Ga0466704_404784 3300042643 Bacteria 19036
79 Ga0466724_50901 3300042649 Bacteria 4011
80 Ga0466708_053951 3300042652 Bacteria 19818
81 Ga0466708_079679 3300042652 Bacteria 41277
82 Ga0466723_345366 3300042618 Bacteria 19928
83 Ga0466729_117205 3300042621 Bacteria 50557
84 Ga0466656_385658 3300042550 Bacteria 2440
85 Ga0466696_252112 3300042596 Bacteria 2768
86 Ga0466696_300257 3300042596 Bacteria 1223
87 Ga0123357_10013005 3300009784 Bacteria 10764
88 Ga0123355_10361429 3300009826 Bacteria 1912
89 Ga0123356_10000134 3300010049 Bacteria 82554
90 Ga0123356_10007080 3300010049 Bacteria 11238
91 Ga0123356_10040250 3300010049 Bacteria 4355
92 Ga0123356_10156577 3300010049 Bacteria 2270
93 Ga0123356_10229743 3300010049 Bacteria 1919
94 Ga0123356_10245587 3300010049 Bacteria 1864
95 Ga0123353_10011361 3300010167 Bacteria 12538
96 Ga0123353_10025626 3300010167 Bacteria 8990
97 Ga0123353_10379484 3300010167 Bacteria 2115
98 Ga0123354_10002502 3300010882 Bacteria 24370
99 Ga0466706_020366 3300042599 Bacteria 2655
100 Ga0466722_005776 3300042609 Bacteria 2210
101 IMNBL1DRAFT_c0024307 3300000062 Bacteria 2352
102 Ga0466705_365823 3300042612 Bacteria 22090
103 Ga0466703_203929 3300042636 Bacteria 4723
104 Ga0466715_043804 3300042616 Bacteria 8517
105 Ga0466715_116646 3300042616 Bacteria 13720
106 Ga0466715_140298 3300042616 Bacteria 1177
107 Ga0466715_330755 3300042616 Bacteria 2054
108 Ga0466729_155158 3300042621 Bacteria 5707
109 Ga0466691_192340 3300042593 Bacteria 1041
110 Ga0123357_10004444 3300009784 Bacteria 16465
111 Ga0123357_10006163 3300009784 Bacteria 14543
112 Ga0123355_10002506 3300009826 Bacteria 26020
113 Ga0123355_10005323 3300009826 Bacteria 18809
114 Ga0123355_10070886 3300009826 Bacteria 5596
115 Ga0123355_10404777 3300009826 Bacteria 1757
116 Ga0123356_10494630 3300010049 Bacteria 1378
117 Ga0123353_10130818 3300010167 Bacteria 4027
118 Ga0123354_10252186 3300010882 Bacteria 1784
119 Ga0466733_033791 3300042659 Bacteria 1015
120 Ga0466707_012192 3300042601 Bacteria 7479
121 Ga0466707_322026 3300042601 Bacteria 13036
122 Ga0466707_413321 3300042601 Bacteria 5124
123 Ga0466713_092327 3300042602 Bacteria 48279
124 Ga0466713_155303 3300042602 Bacteria 17735
125 Ga0466734_057233 3300042623 Bacteria 1227
126 Ga0466735_070774 3300042624 Bacteria 15100
127 Ga0466735_176291 3300042624 Bacteria 2512
128 Ga0466735_194848 3300042624 Bacteria 5945
129 Ga0466704_011432 3300042643 Bacteria 3802
130 Ga0466704_116481 3300042643 Bacteria 45712
131 Ga0466709_009067 3300042648 Bacteria 2740
132 Ga0466727_171524 3300042655 Bacteria 3228
133 Ga0466711_355509 3300042615 Bacteria 12832
134 Ga0466711_372501 3300042615 Bacteria 489210
135 Ga0466711_488791 3300042615 Bacteria 1451
136 Ga0466715_643287 3300042616 Bacteria 2289
137 Ga0466692_138200 3300042591 Bacteria 4068
138 Ga0123355_10000171 3300009826 Bacteria 79083
139 Ga0123355_10118098 3300009826 Bacteria 4122
140 Ga0123356_10000157 3300010049 Bacteria 76908
141 Ga0123356_10091638 3300010049 Bacteria 2897
142 Ga0123356_10209381 3300010049 Bacteria 1997
143 Ga0123356_10308670 3300010049 Bacteria 1690
144 Ga0123353_10008575 3300010167 Bacteria 13986
145 Ga0123353_10122215 3300010167 Bacteria 4185
146 Ga0123353_10323878 3300010167 Bacteria 2337
147 Ga0123353_11210651 3300010167 Bacteria 990
148 Ga0466716_470771 3300042605 Bacteria 2675
149 Ga0466719_173332 3300042606 Bacteria 2834
150 Ga0466719_287038 3300042606 Bacteria 1088
151 IMNBL1DRAFT_c0010323 3300000062 Bacteria 4493
152 Ga0466735_050544 3300042624 Bacteria 5700
153 Ga0466735_146156 3300042624 Bacteria 2781
154 Ga0466704_031146 3300042643 Bacteria 38318
155 Ga0466727_263039 3300042655 Bacteria 14042
156 Ga0466715_051700 3300042616 Bacteria 2899
157 Ga0466726_228652 3300042619 Bacteria 2681
158 Ga0466728_082463 3300042620 Bacteria 32980
159 Ga0415639_095664 3300038395 Bacteria 1596
160 Ga0466692_130735 3300042591 Bacteria 26218
161 Ga0466691_140188 3300042593 Bacteria 4047
162 Ga0123355_10092527 3300009826 Bacteria 4789
163 Ga0123355_10095583 3300009826 Bacteria 4695
164 Ga0123355_10115160 3300009826 Bacteria 4188
165 Ga0123356_10068223 3300010049 Bacteria 3331
166 Ga0123356_10208379 3300010049 Bacteria 2001
167 Ga0123356_10285799 3300010049 Bacteria 1747
168 Ga0123353_10008697 3300010167 Bacteria 13893
169 Ga0123353_10013104 3300010167 Bacteria 11852
170 Ga0123353_10148074 3300010167 Bacteria 3752
171 Ga0123353_10253219 3300010167 Bacteria 2725
172 Ga0123353_10257379 3300010167 Bacteria 2699
173 Ga0123353_10436325 3300010167 Bacteria 1934
174 Ga0123353_10488280 3300010167 Unclassified 1799
175 Ga0123353_10672929 3300010167 Bacteria 1460
176 Ga0123353_10957340 3300010167 Bacteria 1157
177 Ga0466706_166478 3300042599 Bacteria 103376
178 JGI24702J35022_10034844 3300002462 Bacteria 2692
179 Ga0068302_10001564 3300005071 Bacteria 20938
180 Ga0466705_357809 3300042612 Bacteria 37083
181 Ga0466735_053051 3300042624 Bacteria 11352
182 Ga0466735_172430 3300042624 Bacteria 13043
183 Ga0466704_375586 3300042643 Bacteria 37503
184 Ga0466727_214209 3300042655 Bacteria 66628
185 Ga0466711_300045 3300042615 Bacteria 6202
186 Ga0466728_219928 3300042620 Bacteria 3500
187 Ga0466728_250120 3300042620 Bacteria 1710
188 Ga0264413_157352 3300024493 Bacteria 1982
189 Ga0415639_119459 3300038395 Bacteria 1551
190 Ga0466696_265464 3300042596 Bacteria 21014
191 Ga0123355_10026081 3300009826 Bacteria 9422
192 Ga0123355_10124998 3300009826 Bacteria 3977
193 Ga0123356_10056569 3300010049 Bacteria 3655
194 Ga0123356_10167745 3300010049 Bacteria 2202
195 Ga0123356_10202245 3300010049 Bacteria 2027
196 Ga0123356_10247837 3300010049 Bacteria 1857
197 Ga0123356_10663955 3300010049 Bacteria 1210
198 Ga0123356_11162781 3300010049 Bacteria 939
199 Ga0123353_10164135 3300010167 Bacteria 3533
200 Ga0123353_11543639 3300010167 Bacteria 843
201 Ga0123354_10217085 3300010882 Bacteria 2046

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00557 Peptidase_M24 Metallopeptidase family M24 41 275 0.9

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.