Protein Family IF09140
Metagenome
Isolate
145
Members
50
Samples
138
Scaffolds
196.68
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_100612|Ga0466703_100612_34051_34719
- Length
- 222 aa
- Sequence
- MIQVSVFVYTFFSLFGKLAGMTATKRNPGERIAELCKTYSISRETLAERSGLDPELIRRIEEEEHIPDLAPLLKISRALGVRLGTLLDDHEELGPVITRKGQASDTARFITGNPADGSRAAGSGSRDAAGKGHYFHALAADKGSRHMEPFIVDMEHDEDQPKSSHEGEEFIYILEGTIKVEYGKDSYTVNTGDSIYYDSIVPHRVFSSGGAARILAVIYTPA
Sample Types
Isolate
4.8%
Metagenome
95.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.2%
Kalotermitidae
27.1%
Blattidae
12.5%
Termopsidae
8.3%
Rhinotermitidae
6.2%
Unclassified
6.2%
Passalidae
6.2%
Hodotermitidae
2.1%
Taxonomy
Archaea
12
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2773857682 | Unclassified Methanosarcinaceae Lab288P3bin112 | Isolate | Unclassified |
| 20 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 21 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 37 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 38 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 39 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 45 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 46 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 47 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 48 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 49 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_286942 | 3300042612 | Bacteria | 1338 |
| 2 | Ga0466733_106142 | 3300042659 | Bacteria | 10504 |
| 3 | Ga0123353_10622555 | 3300010167 | Bacteria | 1536 |
| 4 | Ga0466716_240294 | 3300042605 | Bacteria | 4955 |
| 5 | Ga0265387_1034017 | 3300024582 | Bacteria | 841 |
| 6 | Ga0265387_1072108 | 3300024582 | Bacteria | 668 |
| 7 | Ga0466690_002240 | 3300042590 | Bacteria | 6015 |
| 8 | Ga0466692_047488 | 3300042591 | Bacteria | 2578 |
| 9 | Ga0466703_100612 | 3300042636 | Bacteria | 66039 |
| 10 | Ga0466704_167651 | 3300042643 | Bacteria | 19990 |
| 11 | Ga0466708_021806 | 3300042652 | Bacteria | 4204 |
| 12 | 2227466015 | 2225789004 | Archaea | 5155 |
| 13 | Ga0466733_044201 | 3300042659 | Bacteria | 54685 |
| 14 | Ga0466718_030714 | 3300042617 | Bacteria | 8515 |
| 15 | Ga0466718_050537 | 3300042617 | Bacteria | 8628 |
| 16 | Ga0466723_269121 | 3300042618 | Bacteria | 8345 |
| 17 | Ga0466706_281851 | 3300042599 | Bacteria | 2335 |
| 18 | Ga0466719_312720 | 3300042606 | Bacteria | 2092 |
| 19 | Ga0466722_216757 | 3300042609 | Bacteria | 8578 |
| 20 | Ga0466699_206045 | 3300042597 | Bacteria | 8454 |
| 21 | Ga0466703_047869 | 3300042636 | Bacteria | 58815 |
| 22 | Ga0466709_186893 | 3300042648 | Bacteria | 9141 |
| 23 | Ga0466727_324338 | 3300042655 | Bacteria | 3804 |
| 24 | 2227656846 | 2225789004 | Archaea | 1969 |
| 25 | JGI24698J34947_10000025 | 3300002449 | Bacteria | 40185 |
| 26 | Ga0466733_123192 | 3300042659 | Archaea | 34981 |
| 27 | Ga0466723_287759 | 3300042618 | Bacteria | 52406 |
| 28 | Ga0466726_413173 | 3300042619 | Bacteria | 1920 |
| 29 | Ga0466726_458492 | 3300042619 | Unclassified | 1631 |
| 30 | Ga0123353_10000188 | 3300010167 | Archaea | 78260 |
| 31 | Ga0466701_101364 | 3300042598 | Bacteria | 1386 |
| 32 | Ga0466707_049794 | 3300042601 | Bacteria | 3051 |
| 33 | Ga0466707_129077 | 3300042601 | Bacteria | 2725 |
| 34 | Ga0466707_354635 | 3300042601 | Bacteria | 1165 |
| 35 | Ga0466713_145001 | 3300042602 | Unclassified | 1941 |
| 36 | Ga0466716_207710 | 3300042605 | Bacteria | 35454 |
| 37 | Ga0415639_112510 | 3300038395 | Bacteria | 1670 |
| 38 | Ga0466699_157424 | 3300042597 | Bacteria | 1557 |
| 39 | Ga0466708_315749 | 3300042652 | Bacteria | 28028 |
| 40 | Ga0466727_212494 | 3300042655 | Bacteria | 13739 |
| 41 | Ga0466727_233850 | 3300042655 | Bacteria | 2502 |
| 42 | IMNBL1DRAFT_c0138185 | 3300000062 | Bacteria | 631 |
| 43 | JGI24702J35022_10112104 | 3300002462 | Archaea | 1500 |
| 44 | Ga0466733_064984 | 3300042659 | Bacteria | 6097 |
| 45 | Ga0466733_164040 | 3300042659 | Bacteria | 19007 |
| 46 | Ga0466715_048251 | 3300042616 | Bacteria | 81213 |
| 47 | Ga0466729_175152 | 3300042621 | Bacteria | 1163 |
| 48 | Ga0123355_10175115 | 3300009826 | Unclassified | 3197 |
| 49 | Ga0123356_10239949 | 3300010049 | Unclassified | 1883 |
| 50 | Ga0123356_10568734 | 3300010049 | Bacteria | 1296 |
| 51 | Ga0466707_174725 | 3300042601 | Bacteria | 2962 |
| 52 | Ga0466707_346259 | 3300042601 | Unclassified | 1170 |
| 53 | Ga0466719_144976 | 3300042606 | Bacteria | 13137 |
| 54 | Ga0466719_284667 | 3300042606 | Bacteria | 1409 |
| 55 | Ga0466722_058686 | 3300042609 | Bacteria | 14294 |
| 56 | Ga0466722_185517 | 3300042609 | Bacteria | 15757 |
| 57 | Ga0466692_177329 | 3300042591 | Bacteria | 3972 |
| 58 | Ga0466699_411785 | 3300042597 | Bacteria | 2765 |
| 59 | Ga0466735_020465 | 3300042624 | Bacteria | 2001 |
| 60 | Ga0466702_313041 | 3300042635 | Bacteria | 9190 |
| 61 | Ga0466703_357755 | 3300042636 | Bacteria | 20094 |
| 62 | Ga0466708_134260 | 3300042652 | Bacteria | 1796 |
| 63 | Ga0466708_238189 | 3300042652 | Bacteria | 7805 |
| 64 | Ga0466727_013981 | 3300042655 | Archaea | 1620 |
| 65 | IMNBL1DRAFT_c0006737 | 3300000062 | Archaea | 6215 |
| 66 | IMNBL1DRAFT_c0047584 | 3300000062 | Unclassified | 1383 |
| 67 | Ga0466697_111395 | 3300042611 | Bacteria | 3482 |
| 68 | Ga0466733_076886 | 3300042659 | Bacteria | 33267 |
| 69 | Ga0466733_162813 | 3300042659 | Bacteria | 1577 |
| 70 | Ga0466711_048821 | 3300042615 | Bacteria | 11804 |
| 71 | Ga0466711_401048 | 3300042615 | Bacteria | 13916 |
| 72 | Ga0466718_015162 | 3300042617 | Bacteria | 17755 |
| 73 | Ga0466718_056848 | 3300042617 | Bacteria | 7626 |
| 74 | Ga0466723_149634 | 3300042618 | Bacteria | 3269 |
| 75 | Ga0466723_227236 | 3300042618 | Bacteria | 5030 |
| 76 | Ga0123356_10807400 | 3300010049 | Archaea | 1109 |
| 77 | Ga0466707_020194 | 3300042601 | Bacteria | 1922 |
| 78 | Ga0466713_011773 | 3300042602 | Bacteria | 8481 |
| 79 | Ga0466719_050147 | 3300042606 | Bacteria | 5295 |
| 80 | Ga0264413_133694 | 3300024493 | Bacteria | 2679 |
| 81 | Ga0466690_238003 | 3300042590 | Bacteria | 1152 |
| 82 | Ga0466692_108833 | 3300042591 | Bacteria | 2305 |
| 83 | Ga0466696_121016 | 3300042596 | Bacteria | 24238 |
| 84 | Ga0466699_441353 | 3300042597 | Bacteria | 2202 |
| 85 | Ga0466729_217235 | 3300042621 | Bacteria | 1040 |
| 86 | Ga0466702_321330 | 3300042635 | Bacteria | 1019 |
| 87 | Ga0466704_225547 | 3300042643 | Bacteria | 39919 |
| 88 | Ga0466727_024830 | 3300042655 | Bacteria | 3287 |
| 89 | Ga0466711_022336 | 3300042615 | Bacteria | 5104 |
| 90 | Ga0466715_081309 | 3300042616 | Bacteria | 9125 |
| 91 | Ga0466726_003819 | 3300042619 | Bacteria | 7168 |
| 92 | Ga0466726_451779 | 3300042619 | Bacteria | 4195 |
| 93 | Ga0466706_014198 | 3300042599 | Bacteria | 2036 |
| 94 | Ga0466722_214612 | 3300042609 | Bacteria | 1172 |
| 95 | Ga0466692_106435 | 3300042591 | Bacteria | 2872 |
| 96 | Ga0466692_153632 | 3300042591 | Bacteria | 1250 |
| 97 | Ga0466691_034599 | 3300042593 | Bacteria | 5461 |
| 98 | Ga0466696_078835 | 3300042596 | Bacteria | 21700 |
| 99 | Ga0466696_089381 | 3300042596 | Bacteria | 2994 |
| 100 | Ga0466735_117606 | 3300042624 | Bacteria | 1022 |
| 101 | Ga0466703_370479 | 3300042636 | Bacteria | 72306 |
| 102 | Ga0068302_10136747 | 3300005071 | Bacteria | 2126 |
| 103 | Ga0466715_312719 | 3300042616 | Bacteria | 5641 |
| 104 | Ga0466726_012234 | 3300042619 | Unclassified | 1165 |
| 105 | Ga0466729_057120 | 3300042621 | Bacteria | 37274 |
| 106 | Ga0123356_10182293 | 3300010049 | Bacteria | 2123 |
| 107 | Ga0123353_10036960 | 3300010167 | Bacteria | 7655 |
| 108 | Ga0123353_11191313 | 3300010167 | Bacteria | 1001 |
| 109 | Ga0466706_078188 | 3300042599 | Bacteria | 1490 |
| 110 | Ga0466707_223064 | 3300042601 | Bacteria | 1143 |
| 111 | Ga0466707_273854 | 3300042601 | Bacteria | 1544 |
| 112 | Ga0466713_049104 | 3300042602 | Bacteria | 2039 |
| 113 | Ga0466714_122244 | 3300042603 | Bacteria | 1054 |
| 114 | Ga0466692_077788 | 3300042591 | Bacteria | 2632 |
| 115 | Ga0466692_170279 | 3300042591 | Bacteria | 12828 |
| 116 | Ga0466691_193609 | 3300042593 | Bacteria | 3491 |
| 117 | Ga0466699_231283 | 3300042597 | Bacteria | 3477 |
| 118 | Ga0466702_400421 | 3300042635 | Bacteria | 1605 |
| 119 | Ga0466704_289720 | 3300042643 | Bacteria | 2673 |
| 120 | Ga0466733_020164 | 3300042659 | Bacteria | 2682 |
| 121 | Ga0466733_130267 | 3300042659 | Bacteria | 5604 |
| 122 | Ga0466718_120628 | 3300042617 | Bacteria | 7534 |
| 123 | Ga0123353_10862867 | 3300010167 | Bacteria | 1239 |
| 124 | Ga0466716_435585 | 3300042605 | Bacteria | 3070 |
| 125 | Ga0466719_180350 | 3300042606 | Bacteria | 1013 |
| 126 | Ga0466719_202607 | 3300042606 | Bacteria | 14142 |
| 127 | Ga0466719_375632 | 3300042606 | Bacteria | 1215 |
| 128 | Ga0466695_259092 | 3300042595 | Bacteria | 134193 |
| 129 | Ga0466729_300417 | 3300042621 | Unclassified | 1345 |
| 130 | Ga0466735_057905 | 3300042624 | Archaea | 1383 |
| 131 | Ga0466735_169917 | 3300042624 | Bacteria | 1840 |
| 132 | Ga0466704_314205 | 3300042643 | Bacteria | 42787 |
| 133 | Ga0466708_086496 | 3300042652 | Bacteria | 18578 |
| 134 | Ga0466727_301806 | 3300042655 | Unclassified | 2661 |
| 135 | 2227072463 | 2225789003 | Unclassified | 11894 |
| 136 | 2227464924 | 2225789004 | Archaea | 5225 |
| 137 | IMNBL1DRAFT_c0026270 | 3300000062 | Archaea | 2215 |
| 138 | Ga0072940_1025660 | 3300005200 | Bacteria | 4894 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.