Protein Family IF09131
Metagenome
Isolate
135
Members
45
Samples
131
Scaffolds
349.91
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_084405|Ga0466703_084405_2404_3582
- Length
- 392 aa
- Sequence
- MPSFRLSCPMLIRYPHHRGGGKNYFIDKIMPPMYSDKMESKLSGFSPDYTNIQKAAYNRHPDRMPLYEHIISDTIMEQLSGKKFRHLYNGDLTDKTEYFKHYCGFFRDMGYDSVSFEGCLGLAMPHSGCLGAHKESVIHDYEDFEKYPWDSIPDAYFAMYGEYFQALRSAMPQGMKAIGGVGNGVFECVEDVIGYMNLCYISSDDPELYAALFRKVGDISLSIWKRFMEHYGDIYCVLRFGDDLGFKTSTLISPEDIRRQVIPQYARIIALIHSYNKPFLLHSCGSIFAVMPDIIREAKINAKHSNEDEIAEFPVWVEKYGGEIGNFGGLDTDTLCRCSIPEIRDRAKDILGRCKKPGGIAFGSGNSIPDYVPADHYLEMVHTVREYRGDFF
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.4%
Kalotermitidae
31.8%
Unclassified
13.6%
Rhinotermitidae
6.8%
Termopsidae
6.8%
Hodotermitidae
2.3%
Passalidae
2.3%
Taxonomy
Archaea
0
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 12 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 13 | 2820444930 | Unclassified Firmicutes Lab288P3bin199 | Isolate | Unclassified |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 36 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_089311 | 3300042612 | Bacteria | 7183 |
| 2 | Ga0466707_146949 | 3300042601 | Bacteria | 1243 |
| 3 | Ga0466719_296657 | 3300042606 | Bacteria | 18528 |
| 4 | Ga0466722_023397 | 3300042609 | Bacteria | 4313 |
| 5 | Ga0123355_10143405 | 3300009826 | Bacteria | 3648 |
| 6 | Ga0123355_10234668 | 3300009826 | Bacteria | 2612 |
| 7 | Ga0123355_10459061 | 3300009826 | Bacteria | 1600 |
| 8 | Ga0123356_10011300 | 3300010049 | Bacteria | 8712 |
| 9 | IMNBL1DRAFT_c0006696 | 3300000062 | Bacteria | 6239 |
| 10 | Ga0466705_439957 | 3300042612 | Bacteria | 6627 |
| 11 | Ga0466711_230210 | 3300042615 | Bacteria | 17782 |
| 12 | Ga0466726_427688 | 3300042619 | Bacteria | 2612 |
| 13 | Ga0466703_105237 | 3300042636 | Bacteria | 1768 |
| 14 | Ga0466703_252077 | 3300042636 | Bacteria | 15347 |
| 15 | Ga0466691_057216 | 3300042593 | Bacteria | 8001 |
| 16 | Ga0466694_191367 | 3300042594 | Bacteria | 2049 |
| 17 | Ga0466705_271610 | 3300042612 | Bacteria | 8726 |
| 18 | Ga0466732_079854 | 3300042656 | Bacteria | 3318 |
| 19 | Ga0466701_081801 | 3300042598 | Bacteria | 1401 |
| 20 | Ga0466719_198559 | 3300042606 | Bacteria | 41330 |
| 21 | Ga0123355_10006456 | 3300009826 | Bacteria | 17375 |
| 22 | Ga0123355_10643982 | 3300009826 | Bacteria | 1239 |
| 23 | Ga0123353_10229506 | 3300010167 | Bacteria | 2896 |
| 24 | IMNBL1DRAFT_c0005868 | 3300000062 | Bacteria | 6878 |
| 25 | JGI24698J34947_10000449 | 3300002449 | Bacteria | 19083 |
| 26 | Ga0466715_454234 | 3300042616 | Bacteria | 16445 |
| 27 | Ga0466735_034227 | 3300042624 | Bacteria | 3566 |
| 28 | Ga0466703_010242 | 3300042636 | Bacteria | 19485 |
| 29 | Ga0466704_105401 | 3300042643 | Bacteria | 16631 |
| 30 | Ga0466708_346560 | 3300042652 | Bacteria | 6741 |
| 31 | Ga0466690_311456 | 3300042590 | Bacteria | 2298 |
| 32 | Ga0466694_145660 | 3300042594 | Bacteria | 25513 |
| 33 | Ga0466696_180520 | 3300042596 | Bacteria | 4159 |
| 34 | Ga0466696_311622 | 3300042596 | Bacteria | 3351 |
| 35 | Ga0466707_018402 | 3300042601 | Bacteria | 2197 |
| 36 | Ga0466713_123377 | 3300042602 | Bacteria | 5487 |
| 37 | Ga0466719_375318 | 3300042606 | Bacteria | 15596 |
| 38 | Ga0466722_193529 | 3300042609 | Bacteria | 30621 |
| 39 | Ga0123357_10294445 | 3300009784 | Bacteria | 1651 |
| 40 | Ga0123355_10000928 | 3300009826 | Bacteria | 40502 |
| 41 | Ga0123355_10057518 | 3300009826 | Bacteria | 6292 |
| 42 | Ga0123355_10536604 | 3300009826 | Bacteria | 1422 |
| 43 | IMNBL1DRAFT_c0006958 | 3300000062 | Bacteria | 6053 |
| 44 | Ga0466715_562803 | 3300042616 | Bacteria | 10281 |
| 45 | Ga0466718_113234 | 3300042617 | Bacteria | 2277 |
| 46 | Ga0466726_249790 | 3300042619 | Bacteria | 1582 |
| 47 | Ga0466726_287491 | 3300042619 | Bacteria | 5702 |
| 48 | Ga0466728_233193 | 3300042620 | Bacteria | 1735 |
| 49 | Ga0466703_059065 | 3300042636 | Bacteria | 3713 |
| 50 | Ga0466703_084405 | 3300042636 | Bacteria | 9724 |
| 51 | Ga0466696_098282 | 3300042596 | Bacteria | 9359 |
| 52 | Ga0466696_264998 | 3300042596 | Bacteria | 25297 |
| 53 | Ga0466716_033839 | 3300042605 | Bacteria | 1905 |
| 54 | Ga0123355_10020862 | 3300009826 | Bacteria | 10474 |
| 55 | Ga0123353_10007396 | 3300010167 | Bacteria | 14827 |
| 56 | Ga0123354_10297771 | 3300010882 | Unclassified | 1532 |
| 57 | Ga0466715_074021 | 3300042616 | Bacteria | 1357 |
| 58 | Ga0466715_262385 | 3300042616 | Bacteria | 4550 |
| 59 | Ga0466726_380059 | 3300042619 | Bacteria | 1607 |
| 60 | Ga0466709_281815 | 3300042648 | Bacteria | 1488 |
| 61 | Ga0466719_307224 | 3300042606 | Bacteria | 3235 |
| 62 | Ga0466719_575870 | 3300042606 | Bacteria | 2952 |
| 63 | Ga0466721_142393 | 3300042608 | Bacteria | 1473 |
| 64 | Ga0123357_10356968 | 3300009784 | Bacteria | 1389 |
| 65 | Ga0123353_10166059 | 3300010167 | Bacteria | 3508 |
| 66 | Ga0072941_1051894 | 3300005201 | Bacteria | 10189 |
| 67 | Ga0466715_377807 | 3300042616 | Bacteria | 5813 |
| 68 | Ga0466728_363067 | 3300042620 | Bacteria | 6818 |
| 69 | Ga0466729_016539 | 3300042621 | Bacteria | 2166 |
| 70 | Ga0466692_190055 | 3300042591 | Bacteria | 2378 |
| 71 | Ga0466694_398195 | 3300042594 | Bacteria | 1596 |
| 72 | Ga0466696_375020 | 3300042596 | Bacteria | 2356 |
| 73 | Ga0466705_039992 | 3300042612 | Bacteria | 1888 |
| 74 | Ga0466705_094289 | 3300042612 | Bacteria | 5187 |
| 75 | Ga0466719_295120 | 3300042606 | Bacteria | 2701 |
| 76 | Ga0123357_10056398 | 3300009784 | Bacteria | 5283 |
| 77 | Ga0123355_10021923 | 3300009826 | Bacteria | 10236 |
| 78 | Ga0123355_10482011 | 3300009826 | Bacteria | 1542 |
| 79 | Ga0123356_10110091 | 3300010049 | Bacteria | 2659 |
| 80 | Ga0123353_10696179 | 3300010167 | Bacteria | 1427 |
| 81 | IMNBL1DRAFT_c0000164 | 3300000062 | Bacteria | 59044 |
| 82 | JGI24702J35022_10035690 | 3300002462 | Bacteria | 2659 |
| 83 | Ga0466705_426535 | 3300042612 | Bacteria | 6260 |
| 84 | Ga0466711_109505 | 3300042615 | Bacteria | 28818 |
| 85 | Ga0466715_608053 | 3300042616 | Bacteria | 24934 |
| 86 | Ga0466726_132322 | 3300042619 | Bacteria | 3331 |
| 87 | Ga0466726_406527 | 3300042619 | Bacteria | 1285 |
| 88 | Ga0466729_223314 | 3300042621 | Bacteria | 2003 |
| 89 | Ga0466729_230107 | 3300042621 | Bacteria | 1646 |
| 90 | Ga0466735_234449 | 3300042624 | Bacteria | 1644 |
| 91 | Ga0466704_274626 | 3300042643 | Unclassified | 2231 |
| 92 | Ga0466690_051392 | 3300042590 | Bacteria | 7378 |
| 93 | Ga0466691_055641 | 3300042593 | Bacteria | 3355 |
| 94 | Ga0466694_098497 | 3300042594 | Bacteria | 1728 |
| 95 | Ga0466699_328627 | 3300042597 | Bacteria | 1735 |
| 96 | Ga0466706_053880 | 3300042599 | Bacteria | 2392 |
| 97 | Ga0466720_001632 | 3300042607 | Bacteria | 1720 |
| 98 | Ga0123355_10003508 | 3300009826 | Bacteria | 22515 |
| 99 | Ga0123355_10030413 | 3300009826 | Bacteria | 8750 |
| 100 | Ga0123356_10122034 | 3300010049 | Bacteria | 2537 |
| 101 | Ga0123356_10711280 | 3300010049 | Bacteria | 1174 |
| 102 | Ga0123353_10945734 | 3300010167 | Bacteria | 1166 |
| 103 | JGI24698J34947_10000277 | 3300002449 | Bacteria | 22057 |
| 104 | Ga0074263_118162 | 3300005485 | Bacteria | 1559 |
| 105 | Ga0466715_196457 | 3300042616 | Bacteria | 2924 |
| 106 | Ga0466726_268654 | 3300042619 | Bacteria | 1200 |
| 107 | Ga0466726_486062 | 3300042619 | Bacteria | 1425 |
| 108 | Ga0466704_078195 | 3300042643 | Bacteria | 3062 |
| 109 | Ga0466704_340276 | 3300042643 | Bacteria | 2782 |
| 110 | Ga0466709_296951 | 3300042648 | Bacteria | 3903 |
| 111 | Ga0415639_116998 | 3300038395 | Bacteria | 2531 |
| 112 | Ga0466690_032761 | 3300042590 | Bacteria | 11561 |
| 113 | Ga0466690_420382 | 3300042590 | Bacteria | 8008 |
| 114 | Ga0466694_113543 | 3300042594 | Bacteria | 4165 |
| 115 | Ga0466694_368786 | 3300042594 | Bacteria | 3354 |
| 116 | Ga0466707_019816 | 3300042601 | Bacteria | 11178 |
| 117 | Ga0466716_270677 | 3300042605 | Bacteria | 12900 |
| 118 | Ga0123357_10057841 | 3300009784 | Bacteria | 5209 |
| 119 | Ga0123353_10723213 | 3300010167 | Bacteria | 1392 |
| 120 | Ga0123354_10350283 | 3300010882 | Bacteria | 1318 |
| 121 | Ga0466711_300309 | 3300042615 | Bacteria | 27083 |
| 122 | Ga0466715_085377 | 3300042616 | Bacteria | 4445 |
| 123 | Ga0466723_329251 | 3300042618 | Bacteria | 12730 |
| 124 | Ga0466726_316964 | 3300042619 | Bacteria | 1936 |
| 125 | Ga0466703_268705 | 3300042636 | Bacteria | 5791 |
| 126 | Ga0466704_126012 | 3300042643 | Bacteria | 25030 |
| 127 | Ga0466727_146336 | 3300042655 | Bacteria | 1172 |
| 128 | Ga0466694_026701 | 3300042594 | Bacteria | 6234 |
| 129 | Ga0466696_276217 | 3300042596 | Bacteria | 3540 |
| 130 | Ga0466696_425289 | 3300042596 | Bacteria | 1928 |
| 131 | Ga0466696_489265 | 3300042596 | Bacteria | 7683 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01208 | URO-D | Uroporphyrinogen decarboxylase (URO-D) | 135 | 387 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.