Protein Family IF09115
Metagenome
Isolate
290
Members
61
Samples
277
Scaffolds
372.48
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_056074|Ga0466703_056074_9242_10522
- Length
- 426 aa
- Sequence
- MQMYTHEKAPVPSRLSGVSLLNSPPYIITKNLSIFLKGILFLSPRRRFGMIAGVIGATGYAGAELVRLLAGHPGITGFTLGSVSYEGARIEHIYPNFLGKIEAALVKPEEVVSRSQVVFAALPHGVGEPFAKDCVERGIPFIDLSADFRFGHDQETFAAWYGKPFVHKELRSYSVYGLPELNRSRIRELAASKRVIVGNPGCYPTGASLGAFPALAKGIAGPGTIIVDSASGVTGGGRDPNRSFHYPECADSLSPYKVGAHRHTPEIARNFQAMAAMFAGNAGGVQGPAVIFTPHLAPMNRGILSTIYIPLSASRRPRDVSAGAPRPPIKEIEDRAEEIREEYADFYKAEPFVRILPAGVVAASGRVRQSNFCDISIHLDQGGTTLVVATAIDNMVKGAAGQAVQNMNIIFGFDETDGLKTIPALF
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.3%
Kalotermitidae
23.3%
Unclassified
21.7%
Rhinotermitidae
6.7%
Termopsidae
5.0%
Passalidae
1.7%
Hodotermitidae
1.7%
Blaberidae
1.7%
Taxonomy
Archaea
0
Bacteria
279
Eukaryota
0
Viruses
1
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 13 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 20 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 42 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 43 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 46 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 47 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 50 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 51 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 52 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 53 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 54 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 56 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 57 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 58 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 59 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 60 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_110120 | 3300042612 | Bacteria | 4808 |
| 2 | Ga0466705_120412 | 3300042612 | Bacteria | 7767 |
| 3 | Ga0466733_180381 | 3300042659 | Bacteria | 3536 |
| 4 | JGI24695J34938_10013808 | 3300002450 | Bacteria | 4222 |
| 5 | Ga0072940_1037000 | 3300005200 | Bacteria | 2878 |
| 6 | Ga0466716_119097 | 3300042605 | Bacteria | 4917 |
| 7 | Ga0466719_534132 | 3300042606 | Bacteria | 8973 |
| 8 | Ga0466720_051924 | 3300042607 | Bacteria | 4027 |
| 9 | Ga0466722_184938 | 3300042609 | Unclassified | 13002 |
| 10 | Ga0456237_0001737 | 3300041968 | Unclassified | 3500 |
| 11 | Ga0456237_0003708 | 3300041968 | Bacteria | 2464 |
| 12 | Ga0466692_203343 | 3300042591 | Bacteria | 9278 |
| 13 | Ga0466691_019277 | 3300042593 | Bacteria | 10895 |
| 14 | Ga0466696_330004 | 3300042596 | Bacteria | 17124 |
| 15 | Ga0123355_10000626 | 3300009826 | Bacteria | 47835 |
| 16 | Ga0123353_10306825 | 3300010167 | Bacteria | 2418 |
| 17 | Ga0466705_444448 | 3300042612 | Bacteria | 4777 |
| 18 | Ga0466715_163878 | 3300042616 | Bacteria | 4114 |
| 19 | Ga0466715_186850 | 3300042616 | Bacteria | 3721 |
| 20 | Ga0466715_535466 | 3300042616 | Bacteria | 31187 |
| 21 | Ga0466718_117210 | 3300042617 | Unclassified | 4395 |
| 22 | Ga0466723_160211 | 3300042618 | Bacteria | 3121 |
| 23 | Ga0466723_166293 | 3300042618 | Bacteria | 3031 |
| 24 | Ga0466723_216481 | 3300042618 | Bacteria | 9564 |
| 25 | Ga0466723_219816 | 3300042618 | Bacteria | 36008 |
| 26 | Ga0466726_047399 | 3300042619 | Bacteria | 26624 |
| 27 | Ga0466726_191636 | 3300042619 | Bacteria | 3350 |
| 28 | Ga0466728_168055 | 3300042620 | Bacteria | 64027 |
| 29 | Ga0466728_427041 | 3300042620 | Bacteria | 3886 |
| 30 | Ga0466704_032696 | 3300042643 | Bacteria | 14187 |
| 31 | Ga0466704_527222 | 3300042643 | Bacteria | 45743 |
| 32 | Ga0466709_007625 | 3300042648 | Bacteria | 4642 |
| 33 | Ga0466709_072076 | 3300042648 | Bacteria | 12897 |
| 34 | Ga0466708_172508 | 3300042652 | Bacteria | 10303 |
| 35 | Ga0466708_349847 | 3300042652 | Bacteria | 8514 |
| 36 | Ga0466708_423073 | 3300042652 | Bacteria | 3337 |
| 37 | Ga0466727_259398 | 3300042655 | Bacteria | 1234 |
| 38 | Ga0466705_060872 | 3300042612 | Bacteria | 4362 |
| 39 | Ga0466705_097461 | 3300042612 | Bacteria | 19898 |
| 40 | Ga0466705_172282 | 3300042612 | Bacteria | 6973 |
| 41 | Ga0466733_047181 | 3300042659 | Bacteria | 21674 |
| 42 | Ga0068305_10020742 | 3300005083 | Bacteria | 8916 |
| 43 | Ga0072941_1000093 | 3300005201 | Bacteria | 7204 |
| 44 | Ga0072941_1000583 | 3300005201 | Bacteria | 39939 |
| 45 | Ga0466701_068547 | 3300042598 | Bacteria | 3920 |
| 46 | Ga0466707_118573 | 3300042601 | Bacteria | 1917 |
| 47 | Ga0466716_019777 | 3300042605 | Bacteria | 12449 |
| 48 | Ga0466719_019362 | 3300042606 | Bacteria | 5457 |
| 49 | Ga0466722_111149 | 3300042609 | Bacteria | 6375 |
| 50 | Ga0466722_169481 | 3300042609 | Bacteria | 2498 |
| 51 | Ga0466693_451245 | 3300042592 | Bacteria | 1681 |
| 52 | Ga0466691_034498 | 3300042593 | Bacteria | 10012 |
| 53 | Ga0466691_208915 | 3300042593 | Bacteria | 2373 |
| 54 | Ga0466696_180003 | 3300042596 | Bacteria | 9304 |
| 55 | Ga0466696_345140 | 3300042596 | Bacteria | 17630 |
| 56 | Ga0123353_10626159 | 3300010167 | Bacteria | 1530 |
| 57 | Ga0466711_081626 | 3300042615 | Bacteria | 13680 |
| 58 | Ga0466711_470245 | 3300042615 | Bacteria | 2400 |
| 59 | Ga0466718_118962 | 3300042617 | Bacteria | 5410 |
| 60 | Ga0466723_042811 | 3300042618 | Unclassified | 11929 |
| 61 | Ga0466723_128436 | 3300042618 | Bacteria | 2737 |
| 62 | Ga0466723_159001 | 3300042618 | Bacteria | 43446 |
| 63 | Ga0466723_233221 | 3300042618 | Bacteria | 7723 |
| 64 | Ga0466726_082864 | 3300042619 | Bacteria | 1945 |
| 65 | Ga0466726_132091 | 3300042619 | Bacteria | 2158 |
| 66 | Ga0466726_219615 | 3300042619 | Bacteria | 5713 |
| 67 | Ga0466726_347912 | 3300042619 | Bacteria | 3474 |
| 68 | Ga0466726_410014 | 3300042619 | Bacteria | 3031 |
| 69 | Ga0466728_440249 | 3300042620 | Bacteria | 1515 |
| 70 | Ga0466703_039077 | 3300042636 | Bacteria | 17860 |
| 71 | Ga0466703_125465 | 3300042636 | Bacteria | 10578 |
| 72 | Ga0466703_133125 | 3300042636 | Bacteria | 12461 |
| 73 | Ga0466709_172823 | 3300042648 | Bacteria | 3266 |
| 74 | Ga0466708_131775 | 3300042652 | Bacteria | 2050 |
| 75 | Ga0466708_352798 | 3300042652 | Bacteria | 33544 |
| 76 | Ga0466727_129363 | 3300042655 | Bacteria | 25866 |
| 77 | Ga0466705_279784 | 3300042612 | Bacteria | 4097 |
| 78 | Ga0466705_358682 | 3300042612 | Bacteria | 4104 |
| 79 | Ga0072941_1015217 | 3300005201 | Bacteria | 3600 |
| 80 | Ga0466701_040504 | 3300042598 | Bacteria | 1542 |
| 81 | Ga0466707_098886 | 3300042601 | Bacteria | 2358 |
| 82 | Ga0466716_087653 | 3300042605 | Bacteria | 6465 |
| 83 | Ga0466719_156226 | 3300042606 | Bacteria | 1063 |
| 84 | Ga0466719_517246 | 3300042606 | Bacteria | 2256 |
| 85 | Ga0466722_033351 | 3300042609 | Bacteria | 6294 |
| 86 | Ga0466722_082473 | 3300042609 | Bacteria | 31404 |
| 87 | Ga0466690_120742 | 3300042590 | Bacteria | 2313 |
| 88 | Ga0466690_135785 | 3300042590 | Bacteria | 5143 |
| 89 | Ga0466690_325085 | 3300042590 | Bacteria | 2496 |
| 90 | Ga0466694_206459 | 3300042594 | Bacteria | 1724 |
| 91 | Ga0466695_387234 | 3300042595 | Bacteria | 1605 |
| 92 | Ga0466696_118175 | 3300042596 | Bacteria | 10966 |
| 93 | Ga0123356_10000371 | 3300010049 | Bacteria | 51086 |
| 94 | Ga0123356_10010469 | 3300010049 | Bacteria | 9103 |
| 95 | Ga0123356_10094709 | 3300010049 | Bacteria | 2853 |
| 96 | Ga0466705_481899 | 3300042612 | Bacteria | 3771 |
| 97 | Ga0466711_222136 | 3300042615 | Bacteria | 3567 |
| 98 | Ga0466715_036346 | 3300042616 | Bacteria | 5036 |
| 99 | Ga0466715_163629 | 3300042616 | Bacteria | 2339 |
| 100 | Ga0466715_413172 | 3300042616 | Bacteria | 13310 |
| 101 | Ga0466723_177759 | 3300042618 | Bacteria | 1804 |
| 102 | Ga0466726_343377 | 3300042619 | Bacteria | 1756 |
| 103 | Ga0466729_199809 | 3300042621 | Bacteria | 1574 |
| 104 | Ga0466703_061569 | 3300042636 | Bacteria | 36093 |
| 105 | Ga0466703_187864 | 3300042636 | Bacteria | 71803 |
| 106 | Ga0466703_335383 | 3300042636 | Bacteria | 27062 |
| 107 | Ga0466704_045632 | 3300042643 | Unclassified | 2345 |
| 108 | Ga0466704_076987 | 3300042643 | Bacteria | 12279 |
| 109 | Ga0466727_302947 | 3300042655 | Bacteria | 2066 |
| 110 | Ga0466727_322175 | 3300042655 | Bacteria | 1881 |
| 111 | Ga0466705_103012 | 3300042612 | Unclassified | 2706 |
| 112 | Ga0466705_108215 | 3300042612 | Bacteria | 22164 |
| 113 | Ga0466705_125881 | 3300042612 | Bacteria | 1940 |
| 114 | Ga0466705_256834 | 3300042612 | Bacteria | 2299 |
| 115 | Ga0466733_058416 | 3300042659 | Bacteria | 11660 |
| 116 | Ga0466733_123122 | 3300042659 | Bacteria | 58460 |
| 117 | Ga0466706_060239 | 3300042599 | Bacteria | 1226 |
| 118 | Ga0466707_230546 | 3300042601 | Bacteria | 1472 |
| 119 | Ga0466707_312930 | 3300042601 | Bacteria | 2742 |
| 120 | Ga0466716_458739 | 3300042605 | Bacteria | 19859 |
| 121 | Ga0466716_490878 | 3300042605 | Bacteria | 4507 |
| 122 | Ga0466719_328708 | 3300042606 | Bacteria | 47326 |
| 123 | Ga0466692_144282 | 3300042591 | Bacteria | 15376 |
| 124 | Ga0466694_294254 | 3300042594 | Bacteria | 3876 |
| 125 | Ga0466699_202217 | 3300042597 | Bacteria | 9075 |
| 126 | Ga0466699_324131 | 3300042597 | Bacteria | 19594 |
| 127 | Ga0466699_393380 | 3300042597 | Bacteria | 1619 |
| 128 | Ga0466715_039806 | 3300042616 | Bacteria | 2184 |
| 129 | Ga0466723_029110 | 3300042618 | Bacteria | 12425 |
| 130 | Ga0466723_254257 | 3300042618 | Bacteria | 4792 |
| 131 | Ga0466726_026041 | 3300042619 | Bacteria | 9453 |
| 132 | Ga0466728_278241 | 3300042620 | Bacteria | 9684 |
| 133 | Ga0466735_063380 | 3300042624 | Bacteria | 8701 |
| 134 | Ga0466703_011285 | 3300042636 | Bacteria | 13510 |
| 135 | Ga0466709_012463 | 3300042648 | Bacteria | 23235 |
| 136 | Ga0466727_075536 | 3300042655 | Bacteria | 1595 |
| 137 | JGI24698J34947_10065640 | 3300002449 | Bacteria | 1768 |
| 138 | Ga0466716_133346 | 3300042605 | Bacteria | 1902 |
| 139 | Ga0466716_438831 | 3300042605 | Bacteria | 5235 |
| 140 | Ga0466719_306122 | 3300042606 | Bacteria | 1230 |
| 141 | Ga0466722_197407 | 3300042609 | Bacteria | 7254 |
| 142 | Ga0466698_267307 | 3300042610 | Bacteria | 2014 |
| 143 | Ga0466690_215109 | 3300042590 | Bacteria | 18021 |
| 144 | Ga0466690_357148 | 3300042590 | Bacteria | 13321 |
| 145 | Ga0466692_012733 | 3300042591 | Bacteria | 27371 |
| 146 | Ga0466691_016798 | 3300042593 | Bacteria | 3070 |
| 147 | Ga0466691_024958 | 3300042593 | Bacteria | 7205 |
| 148 | Ga0466691_037938 | 3300042593 | Bacteria | 5092 |
| 149 | Ga0466691_058875 | 3300042593 | Bacteria | 12810 |
| 150 | Ga0466696_062086 | 3300042596 | Unclassified | 5662 |
| 151 | Ga0123356_10000052 | 3300010049 | Bacteria | 124725 |
| 152 | Ga0123354_10181099 | 3300010882 | Bacteria | 2405 |
| 153 | Ga0466711_011436 | 3300042615 | Bacteria | 1211 |
| 154 | Ga0466711_040251 | 3300042615 | Bacteria | 8549 |
| 155 | Ga0466711_043453 | 3300042615 | Bacteria | 2625 |
| 156 | Ga0466711_078092 | 3300042615 | Bacteria | 16770 |
| 157 | Ga0466723_216565 | 3300042618 | Bacteria | 6477 |
| 158 | Ga0466726_185695 | 3300042619 | Bacteria | 8217 |
| 159 | Ga0466726_366903 | 3300042619 | Bacteria | 1697 |
| 160 | Ga0466726_493852 | 3300042619 | Bacteria | 2035 |
| 161 | Ga0466728_114778 | 3300042620 | Bacteria | 12579 |
| 162 | Ga0466729_215058 | 3300042621 | Bacteria | 3947 |
| 163 | Ga0466735_030523 | 3300042624 | Bacteria | 7298 |
| 164 | Ga0466703_056074 | 3300042636 | Bacteria | 18893 |
| 165 | Ga0466703_122309 | 3300042636 | Bacteria | 9322 |
| 166 | Ga0466704_193781 | 3300042643 | Bacteria | 37721 |
| 167 | Ga0466704_281013 | 3300042643 | Bacteria | 21716 |
| 168 | Ga0466704_509293 | 3300042643 | Bacteria | 2299 |
| 169 | Ga0466709_407309 | 3300042648 | Bacteria | 3953 |
| 170 | Ga0466727_118507 | 3300042655 | Bacteria | 5330 |
| 171 | Ga0466727_304497 | 3300042655 | Bacteria | 1542 |
| 172 | Ga0466705_340901 | 3300042612 | Bacteria | 4087 |
| 173 | JGI24698J34947_10032858 | 3300002449 | Bacteria | 2723 |
| 174 | Ga0466706_161936 | 3300042599 | Bacteria | 3830 |
| 175 | Ga0466707_163125 | 3300042601 | Bacteria | 2867 |
| 176 | Ga0466707_415675 | 3300042601 | Bacteria | 3911 |
| 177 | Ga0466713_039582 | 3300042602 | Bacteria | 8835 |
| 178 | Ga0466716_187270 | 3300042605 | Bacteria | 2661 |
| 179 | Ga0466719_100743 | 3300042606 | Bacteria | 8735 |
| 180 | Ga0466720_118586 | 3300042607 | Bacteria | 14195 |
| 181 | Ga0466722_016318 | 3300042609 | Bacteria | 3704 |
| 182 | Ga0466722_026876 | 3300042609 | Bacteria | 4785 |
| 183 | Ga0466722_137630 | 3300042609 | Unclassified | 5091 |
| 184 | Ga0466722_192466 | 3300042609 | Bacteria | 11223 |
| 185 | Ga0466698_326049 | 3300042610 | Bacteria | 7146 |
| 186 | Ga0456237_0000268 | 3300041968 | Bacteria | 7669 |
| 187 | Ga0466690_012785 | 3300042590 | Bacteria | 1913 |
| 188 | Ga0466690_129639 | 3300042590 | Bacteria | 1484 |
| 189 | Ga0466691_027913 | 3300042593 | Bacteria | 52900 |
| 190 | Ga0466691_129862 | 3300042593 | Bacteria | 25527 |
| 191 | Ga0466694_082953 | 3300042594 | Bacteria | 3867 |
| 192 | Ga0466695_018835 | 3300042595 | Bacteria | 15122 |
| 193 | Ga0466696_117625 | 3300042596 | Bacteria | 1913 |
| 194 | Ga0466696_153628 | 3300042596 | Bacteria | 4114 |
| 195 | Ga0466705_455489 | 3300042612 | Bacteria | 5908 |
| 196 | Ga0466715_038453 | 3300042616 | Bacteria | 6642 |
| 197 | Ga0466715_042944 | 3300042616 | Bacteria | 2228 |
| 198 | Ga0466715_515480 | 3300042616 | Bacteria | 10630 |
| 199 | Ga0466718_086583 | 3300042617 | Bacteria | 1314 |
| 200 | Ga0466723_161126 | 3300042618 | Bacteria | 21003 |
| 201 | Ga0466726_409697 | 3300042619 | Bacteria | 12164 |
| 202 | Ga0466704_170339 | 3300042643 | Bacteria | 27113 |
| 203 | Ga0466704_424725 | 3300042643 | Bacteria | 9621 |
| 204 | Ga0466709_057783 | 3300042648 | Bacteria | 12422 |
| 205 | Ga0466709_219111 | 3300042648 | Bacteria | 14676 |
| 206 | Ga0466705_016920 | 3300042612 | Bacteria | 7856 |
| 207 | Ga0466705_292756 | 3300042612 | Viruses | 11324 |
| 208 | Ga0466733_199149 | 3300042659 | Bacteria | 6156 |
| 209 | IMNBL1DRAFT_c0000539 | 3300000062 | Bacteria | 30761 |
| 210 | JGI24702J35022_10085880 | 3300002462 | Bacteria | 1708 |
| 211 | Ga0072941_1009374 | 3300005201 | Unclassified | 14178 |
| 212 | Ga0466707_202947 | 3300042601 | Bacteria | 1416 |
| 213 | Ga0466707_363658 | 3300042601 | Bacteria | 3294 |
| 214 | Ga0466719_084189 | 3300042606 | Bacteria | 1344 |
| 215 | Ga0466719_088309 | 3300042606 | Bacteria | 60348 |
| 216 | Ga0466722_012895 | 3300042609 | Bacteria | 19148 |
| 217 | Ga0466722_017756 | 3300042609 | Bacteria | 2381 |
| 218 | Ga0466722_085471 | 3300042609 | Bacteria | 7789 |
| 219 | Ga0415639_015185 | 3300038395 | Bacteria | 11060 |
| 220 | Ga0466690_037220 | 3300042590 | Bacteria | 10142 |
| 221 | Ga0466690_186779 | 3300042590 | Bacteria | 6619 |
| 222 | Ga0466690_207191 | 3300042590 | Bacteria | 8640 |
| 223 | Ga0466692_066207 | 3300042591 | Bacteria | 2713 |
| 224 | Ga0466691_060866 | 3300042593 | Bacteria | 10277 |
| 225 | Ga0466691_111672 | 3300042593 | Bacteria | 4961 |
| 226 | Ga0466696_348891 | 3300042596 | Bacteria | 7913 |
| 227 | Ga0466699_014471 | 3300042597 | Bacteria | 5691 |
| 228 | Ga0466699_138623 | 3300042597 | Bacteria | 1884 |
| 229 | Ga0123356_10071715 | 3300010049 | Bacteria | 3252 |
| 230 | Ga0123353_10118042 | 3300010167 | Bacteria | 4267 |
| 231 | Ga0466715_093181 | 3300042616 | Bacteria | 9399 |
| 232 | Ga0466715_538722 | 3300042616 | Bacteria | 2190 |
| 233 | Ga0466718_091153 | 3300042617 | Bacteria | 3637 |
| 234 | Ga0466723_112988 | 3300042618 | Bacteria | 28451 |
| 235 | Ga0466723_265862 | 3300042618 | Bacteria | 10606 |
| 236 | Ga0466726_061897 | 3300042619 | Bacteria | 19171 |
| 237 | Ga0466726_118312 | 3300042619 | Bacteria | 1923 |
| 238 | Ga0466726_156258 | 3300042619 | Bacteria | 10512 |
| 239 | Ga0466726_166473 | 3300042619 | Bacteria | 2216 |
| 240 | Ga0466728_057850 | 3300042620 | Bacteria | 12334 |
| 241 | Ga0466729_068182 | 3300042621 | Bacteria | 1901 |
| 242 | Ga0466735_202615 | 3300042624 | Bacteria | 3003 |
| 243 | Ga0466703_010050 | 3300042636 | Bacteria | 13565 |
| 244 | Ga0466703_033444 | 3300042636 | Bacteria | 32477 |
| 245 | Ga0466703_254977 | 3300042636 | Bacteria | 1677 |
| 246 | Ga0466704_090981 | 3300042643 | Bacteria | 18004 |
| 247 | Ga0466704_432424 | 3300042643 | Bacteria | 4987 |
| 248 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 249 | Ga0466708_157405 | 3300042652 | Bacteria | 4901 |
| 250 | Ga0466708_222186 | 3300042652 | Bacteria | 5840 |
| 251 | Ga0466727_032844 | 3300042655 | Bacteria | 17293 |
| 252 | AustNasuHG_c1006702 | 3300000089 | Bacteria | 4105 |
| 253 | Ga0466717_298111 | 3300042604 | Bacteria | 1561 |
| 254 | Ga0466719_034432 | 3300042606 | Bacteria | 8074 |
| 255 | Ga0466719_159104 | 3300042606 | Unclassified | 8077 |
| 256 | Ga0466719_431104 | 3300042606 | Bacteria | 7935 |
| 257 | Ga0466720_090368 | 3300042607 | Bacteria | 39301 |
| 258 | Ga0466690_019605 | 3300042590 | Bacteria | 2528 |
| 259 | Ga0466690_056334 | 3300042590 | Bacteria | 9223 |
| 260 | Ga0466690_171756 | 3300042590 | Bacteria | 2656 |
| 261 | Ga0466691_162911 | 3300042593 | Bacteria | 22853 |
| 262 | Ga0123357_10112747 | 3300009784 | Bacteria | 3459 |
| 263 | Ga0123353_10371440 | 3300010167 | Bacteria | 2144 |
| 264 | Ga0466711_127902 | 3300042615 | Bacteria | 33180 |
| 265 | Ga0466711_476523 | 3300042615 | Bacteria | 21004 |
| 266 | Ga0466723_069685 | 3300042618 | Bacteria | 37935 |
| 267 | Ga0466723_363106 | 3300042618 | Bacteria | 4069 |
| 268 | Ga0466726_336569 | 3300042619 | Bacteria | 3134 |
| 269 | Ga0466728_193553 | 3300042620 | Bacteria | 7108 |
| 270 | Ga0466728_240540 | 3300042620 | Bacteria | 4377 |
| 271 | Ga0466735_228806 | 3300042624 | Bacteria | 2709 |
| 272 | Ga0466703_033642 | 3300042636 | Bacteria | 5018 |
| 273 | Ga0466704_463416 | 3300042643 | Bacteria | 4907 |
| 274 | Ga0466709_083678 | 3300042648 | Bacteria | 6172 |
| 275 | Ga0466709_085566 | 3300042648 | Bacteria | 3374 |
| 276 | Ga0466708_307462 | 3300042652 | Bacteria | 5842 |
| 277 | Ga0466727_069237 | 3300042655 | Bacteria | 3108 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.