Protein Family IF09114
Metagenome
Isolate
169
Members
66
Samples
150
Scaffolds
267.57
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_052763|Ga0466703_052763_6289_7215
- Length
- 308 aa
- Sequence
- LLSLSYYAATRIQPGLFFLANFVYIRVDIVYGGTDMNQNPAPSGHVSCPHCGTITDIETFQRAHKVCGKCNYHTRLNWQERLECTADPGSFKELDPEMESKNPIGFPDYEGKIGALQKNCKTREAVVTGEITINGYPAVIGVMDSYFMMGSMGSVVGEKITRALEYGTAKKLPVIIFTTSGGARMQEGIFSLMQMAKTSGAVARHNEAGQLYISVITDPTTGGVTASFATLGDIIIAEPGALIGFAGKRVIQDTIGQKLPDRFQTAEFVQEHGFTDIIVPRSKMRNILTRFLRMHLPGASTLRGKEAV
Sample Types
Isolate
11.2%
Metagenome
88.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.7%
Unclassified
25.0%
Kalotermitidae
21.9%
Rhinotermitidae
6.2%
Termopsidae
4.7%
Passalidae
3.1%
Apidae
3.1%
Scarabaeidae
1.6%
Elmidae
1.6%
Hodotermitidae
1.6%
Armadillidiidae
1.6%
Taxonomy
Archaea
0
Bacteria
162
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 3 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 4 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 5 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 6 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 7 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 8 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 21 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 27 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 2627854132 | Campylobacter peloridis LMG 23910 | Isolate | Unclassified |
| 31 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 35 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 36 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 2870004507 | Campylobacter coli 14983A | Isolate | Unclassified |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 51 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 52 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 53 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 54 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 55 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 56 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 57 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 58 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 61 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 62 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 63 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 64 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 65 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 66 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_007439 | 3300042659 | Bacteria | 24356 |
| 2 | JGI24695J34938_10018877 | 3300002450 | Bacteria | 3433 |
| 3 | JGI24695J34938_10048420 | 3300002450 | Bacteria | 1872 |
| 4 | Ga0068305_10268578 | 3300005083 | Bacteria | 1618 |
| 5 | Ga0415639_223739 | 3300038395 | Bacteria | 1498 |
| 6 | Ga0466690_046931 | 3300042590 | Bacteria | 2228 |
| 7 | Ga0466692_046346 | 3300042591 | Bacteria | 7154 |
| 8 | Ga0466693_292427 | 3300042592 | Bacteria | 1186 |
| 9 | Ga0466691_129158 | 3300042593 | Bacteria | 30130 |
| 10 | Ga0466706_174067 | 3300042599 | Bacteria | 69356 |
| 11 | Ga0466700_118532 | 3300042600 | Bacteria | 2842 |
| 12 | Ga0466714_049523 | 3300042603 | Bacteria | 1559 |
| 13 | Ga0466719_265187 | 3300042606 | Bacteria | 1723 |
| 14 | Ga0466705_118554 | 3300042612 | Bacteria | 4730 |
| 15 | Ga0466705_196362 | 3300042612 | Bacteria | 6706 |
| 16 | Ga0466705_322930 | 3300042612 | Bacteria | 7670 |
| 17 | Ga0466703_052763 | 3300042636 | Bacteria | 9144 |
| 18 | Ga0466703_098927 | 3300042636 | Bacteria | 24801 |
| 19 | Ga0466704_301502 | 3300042643 | Bacteria | 29784 |
| 20 | Ga0466704_340096 | 3300042643 | Bacteria | 1070 |
| 21 | Ga0466709_263507 | 3300042648 | Bacteria | 2761 |
| 22 | Ga0466727_034945 | 3300042655 | Bacteria | 1158 |
| 23 | Ga0466718_052095 | 3300042617 | Bacteria | 6665 |
| 24 | Ga0123353_10894487 | 3300010167 | Bacteria | 1210 |
| 25 | Ga0466733_056180 | 3300042659 | Bacteria | 2099 |
| 26 | Ga0466733_183100 | 3300042659 | Bacteria | 1668 |
| 27 | JGI24695J34938_10001740 | 3300002450 | Bacteria | 18007 |
| 28 | JGI24695J34938_10053438 | 3300002450 | Unclassified | 1757 |
| 29 | Ga0456237_0007870 | 3300041968 | Unclassified | 1630 |
| 30 | Ga0466690_025431 | 3300042590 | Bacteria | 3236 |
| 31 | Ga0466690_251136 | 3300042590 | Bacteria | 7913 |
| 32 | Ga0466696_022862 | 3300042596 | Bacteria | 3974 |
| 33 | Ga0466707_053223 | 3300042601 | Bacteria | 12046 |
| 34 | Ga0466716_076866 | 3300042605 | Bacteria | 7068 |
| 35 | Ga0466716_393695 | 3300042605 | Bacteria | 5492 |
| 36 | Ga0466719_409311 | 3300042606 | Bacteria | 2961 |
| 37 | Ga0466705_082072 | 3300042612 | Bacteria | 49126 |
| 38 | Ga0466704_110556 | 3300042643 | Bacteria | 2698 |
| 39 | Ga0466709_305276 | 3300042648 | Bacteria | 3433 |
| 40 | Ga0466708_423789 | 3300042652 | Bacteria | 1412 |
| 41 | Ga0466727_129776 | 3300042655 | Bacteria | 3048 |
| 42 | Ga0466727_261458 | 3300042655 | Bacteria | 1683 |
| 43 | Ga0466715_149053 | 3300042616 | Bacteria | 10951 |
| 44 | Ga0466726_268175 | 3300042619 | Bacteria | 27512 |
| 45 | Ga0123355_10006486 | 3300009826 | Bacteria | 17349 |
| 46 | Ga0123355_10008062 | 3300009826 | Bacteria | 15888 |
| 47 | Ga0123355_10255905 | 3300009826 | Bacteria | 2457 |
| 48 | Ga0123355_10323841 | 3300009826 | Bacteria | 2073 |
| 49 | Ga0123353_10638677 | 3300010167 | Bacteria | 1510 |
| 50 | Ga0123354_10323656 | 3300010882 | Bacteria | 1418 |
| 51 | JGI24695J34938_10010999 | 3300002450 | Bacteria | 4912 |
| 52 | Ga0072940_1049168 | 3300005200 | Bacteria | 6904 |
| 53 | Ga0456237_0009708 | 3300041968 | Bacteria | 1431 |
| 54 | Ga0466690_017336 | 3300042590 | Bacteria | 17990 |
| 55 | Ga0466696_451184 | 3300042596 | Bacteria | 9729 |
| 56 | Ga0466700_002221 | 3300042600 | Unclassified | 1730 |
| 57 | Ga0466716_324924 | 3300042605 | Bacteria | 2027 |
| 58 | Ga0466719_420892 | 3300042606 | Bacteria | 6123 |
| 59 | Ga0466703_185580 | 3300042636 | Bacteria | 3383 |
| 60 | Ga0466708_287596 | 3300042652 | Bacteria | 10158 |
| 61 | Ga0466727_254323 | 3300042655 | Bacteria | 2622 |
| 62 | Ga0466727_288491 | 3300042655 | Bacteria | 61584 |
| 63 | Ga0466715_535386 | 3300042616 | Unclassified | 2453 |
| 64 | Ga0466723_099381 | 3300042618 | Bacteria | 45625 |
| 65 | Ga0466726_044505 | 3300042619 | Bacteria | 34716 |
| 66 | Ga0466726_479502 | 3300042619 | Bacteria | 11718 |
| 67 | Ga0123355_10717860 | 3300009826 | Bacteria | 1141 |
| 68 | Ga0123353_10544836 | 3300010167 | Bacteria | 1675 |
| 69 | Ga0160464_101697 | 3300012805 | Bacteria | 6267 |
| 70 | Ga0466733_115042 | 3300042659 | Bacteria | 8117 |
| 71 | Ga0466733_142022 | 3300042659 | Bacteria | 7869 |
| 72 | 2227487420 | 2225789004 | Bacteria | 4204 |
| 73 | IMNBL1DRAFT_c0000044 | 3300000062 | Bacteria | 114546 |
| 74 | JGI24695J34938_10054006 | 3300002450 | Bacteria | 1744 |
| 75 | Ga0466691_009179 | 3300042593 | Bacteria | 2784 |
| 76 | Ga0466691_104254 | 3300042593 | Bacteria | 10326 |
| 77 | Ga0466694_255516 | 3300042594 | Bacteria | 1425 |
| 78 | Ga0466714_049014 | 3300042603 | Bacteria | 50282 |
| 79 | Ga0466716_077923 | 3300042605 | Bacteria | 9497 |
| 80 | Ga0466722_160110 | 3300042609 | Bacteria | 27287 |
| 81 | Ga0466705_064004 | 3300042612 | Bacteria | 7889 |
| 82 | Ga0466727_055904 | 3300042655 | Bacteria | 3535 |
| 83 | Ga0466711_094319 | 3300042615 | Bacteria | 9155 |
| 84 | Ga0466715_407700 | 3300042616 | Bacteria | 7439 |
| 85 | Ga0466718_146634 | 3300042617 | Bacteria | 18755 |
| 86 | Ga0466723_061062 | 3300042618 | Bacteria | 33737 |
| 87 | Ga0466733_002163 | 3300042659 | Bacteria | 2087 |
| 88 | AustNasuHG_c1014967 | 3300000089 | Bacteria | 2626 |
| 89 | JGI24695J34938_10002276 | 3300002450 | Bacteria | 14821 |
| 90 | Ga0160445_105942 | 3300012847 | Bacteria | 2036 |
| 91 | Ga0466692_138760 | 3300042591 | Bacteria | 9180 |
| 92 | Ga0466706_176474 | 3300042599 | Bacteria | 2399 |
| 93 | Ga0466716_111971 | 3300042605 | Bacteria | 10084 |
| 94 | Ga0466705_052750 | 3300042612 | Bacteria | 3102 |
| 95 | Ga0466702_140498 | 3300042635 | Bacteria | 2625 |
| 96 | Ga0466704_051108 | 3300042643 | Bacteria | 9065 |
| 97 | Ga0466725_319496 | 3300042654 | Bacteria | 1934 |
| 98 | Ga0466715_051983 | 3300042616 | Bacteria | 7067 |
| 99 | Ga0466726_477644 | 3300042619 | Bacteria | 2464 |
| 100 | Ga0466728_299172 | 3300042620 | Bacteria | 6335 |
| 101 | Ga0123355_10021588 | 3300009826 | Bacteria | 10307 |
| 102 | Ga0123356_10000443 | 3300010049 | Bacteria | 47239 |
| 103 | Ga0123356_10276475 | 3300010049 | Bacteria | 1772 |
| 104 | Ga0123353_10753097 | 3300010167 | Bacteria | 1355 |
| 105 | Ga0068302_10188643 | 3300005071 | Unclassified | 1754 |
| 106 | Ga0466690_042690 | 3300042590 | Bacteria | 1434 |
| 107 | Ga0466717_019389 | 3300042604 | Bacteria | 2864 |
| 108 | Ga0466719_246711 | 3300042606 | Bacteria | 1287 |
| 109 | Ga0466719_332429 | 3300042606 | Bacteria | 19103 |
| 110 | Ga0466705_159340 | 3300042612 | Bacteria | 11079 |
| 111 | Ga0466729_248815 | 3300042621 | Bacteria | 1236 |
| 112 | Ga0466704_377097 | 3300042643 | Bacteria | 7987 |
| 113 | Ga0466704_412649 | 3300042643 | Bacteria | 8139 |
| 114 | Ga0466727_085083 | 3300042655 | Bacteria | 1621 |
| 115 | Ga0466727_232519 | 3300042655 | Bacteria | 7095 |
| 116 | Ga0466718_062459 | 3300042617 | Bacteria | 5202 |
| 117 | Ga0466726_335689 | 3300042619 | Bacteria | 1812 |
| 118 | Ga0123355_10295390 | 3300009826 | Bacteria | 2217 |
| 119 | Ga0123356_10000870 | 3300010049 | Bacteria | 33535 |
| 120 | Ga0123356_10059478 | 3300010049 | Bacteria | 3564 |
| 121 | Ga0160454_100141 | 3300012798 | Bacteria | 86809 |
| 122 | JGI24700J35501_10930878 | 3300002508 | Bacteria | 32238 |
| 123 | Ga0415639_024480 | 3300038395 | Bacteria | 18993 |
| 124 | Ga0466696_022290 | 3300042596 | Bacteria | 7119 |
| 125 | Ga0466696_076757 | 3300042596 | Bacteria | 4216 |
| 126 | Ga0466705_071649 | 3300042612 | Bacteria | 8104 |
| 127 | Ga0466704_205437 | 3300042643 | Bacteria | 4141 |
| 128 | Ga0466711_352525 | 3300042615 | Bacteria | 66792 |
| 129 | Ga0466723_008088 | 3300042618 | Bacteria | 14230 |
| 130 | Ga0466726_033472 | 3300042619 | Bacteria | 17135 |
| 131 | Ga0123356_10397306 | 3300010049 | Unclassified | 1515 |
| 132 | JGI24695J34938_10005699 | 3300002450 | Bacteria | 7689 |
| 133 | Ga0068305_10001806 | 3300005083 | Bacteria | 20416 |
| 134 | Ga0068305_10033509 | 3300005083 | Bacteria | 17914 |
| 135 | Ga0456237_0000756 | 3300041968 | Bacteria | 5007 |
| 136 | Ga0466691_064265 | 3300042593 | Unclassified | 1478 |
| 137 | Ga0466691_098937 | 3300042593 | Bacteria | 12001 |
| 138 | Ga0466706_232761 | 3300042599 | Bacteria | 14330 |
| 139 | Ga0466700_156919 | 3300042600 | Bacteria | 1209 |
| 140 | Ga0466707_073077 | 3300042601 | Bacteria | 2209 |
| 141 | Ga0466707_299201 | 3300042601 | Bacteria | 2070 |
| 142 | Ga0466719_202519 | 3300042606 | Bacteria | 25647 |
| 143 | Ga0466705_124090 | 3300042612 | Bacteria | 3668 |
| 144 | Ga0466703_021914 | 3300042636 | Bacteria | 11318 |
| 145 | Ga0466703_037201 | 3300042636 | Bacteria | 6431 |
| 146 | Ga0466727_325696 | 3300042655 | Bacteria | 2498 |
| 147 | Ga0466715_093956 | 3300042616 | Bacteria | 2594 |
| 148 | Ga0466728_194599 | 3300042620 | Bacteria | 3997 |
| 149 | Ga0123355_10003524 | 3300009826 | Bacteria | 22464 |
| 150 | Ga0123353_11000206 | 3300010167 | Bacteria | 1124 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01039 | Carboxyl_trans | Carboxyl transferase domain | 79 | 259 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.