Protein Family IF09097
Metagenome
Isolate
203
Members
74
Samples
179
Scaffolds
119.61
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_032512|Ga0466703_032512_1815_2195
- Length
- 126 aa
- Sequence
- MQKGKIMEQLTPQEEQLMLYVWETGKGFIKDFRNKYPGDSKPPYTTVATIMKKLEAKGYVLATLYGNTYEYRPKIKRDKYKSHYVSDLVSNYFQNSYKEMVSFFAREEKLSEQDLEDIIQLIKKRK
Sample Types
Isolate
11.8%
Metagenome
88.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.9%
Kalotermitidae
19.2%
Blattidae
17.8%
Unclassified
12.3%
Rhinotermitidae
6.8%
Termopsidae
4.1%
Hydrophilidae
2.7%
Passalidae
2.7%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
34
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 3 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 23 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 24 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 25 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 26 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 35 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 36 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 42 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 43 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 44 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 52 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 53 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 54 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 55 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 56 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 57 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 58 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 59 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 62 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 63 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 64 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 65 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 68 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 69 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 70 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 72 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 73 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 74 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_175709 | 3300042611 | Unclassified | 1165 |
| 2 | Ga0466657_164332 | 3300042582 | Bacteria | 1258 |
| 3 | Ga0466692_196455 | 3300042591 | Bacteria | 23185 |
| 4 | Ga0466693_161735 | 3300042592 | Unclassified | 1000 |
| 5 | Ga0466696_001458 | 3300042596 | Bacteria | 20710 |
| 6 | Ga0466711_104691 | 3300042615 | Bacteria | 11723 |
| 7 | Ga0466726_412765 | 3300042619 | Unclassified | 1262 |
| 8 | Ga0466729_126291 | 3300042621 | Bacteria | 3881 |
| 9 | Ga0123357_10004693 | 3300009784 | Unclassified | 16140 |
| 10 | Ga0123357_10169758 | 3300009784 | Unclassified | 2585 |
| 11 | Ga0123356_10382174 | 3300010049 | Bacteria | 1541 |
| 12 | Ga0123354_10001279 | 3300010882 | Bacteria | 29888 |
| 13 | Ga0123354_10157199 | 3300010882 | Bacteria | 2721 |
| 14 | Ga0466707_070027 | 3300042601 | Bacteria | 6996 |
| 15 | Ga0466713_039592 | 3300042602 | Bacteria | 11904 |
| 16 | Ga0466719_034015 | 3300042606 | Bacteria | 3284 |
| 17 | IMNBL1DRAFT_c0012226 | 3300000062 | Bacteria | 3943 |
| 18 | JGI24695J34938_10141665 | 3300002450 | Bacteria | 982 |
| 19 | JGI24702J35022_10238003 | 3300002462 | Bacteria | 1055 |
| 20 | JGI24699J35502_11134217 | 3300002509 | Bacteria | 65443 |
| 21 | JGI24696J40584_12533832 | 3300002834 | Unclassified | 616 |
| 22 | Ga0466734_042091 | 3300042623 | Bacteria | 1916 |
| 23 | Ga0466735_207584 | 3300042624 | Bacteria | 2662 |
| 24 | Ga0466703_079158 | 3300042636 | Unclassified | 6088 |
| 25 | Ga0466704_542283 | 3300042643 | Bacteria | 38270 |
| 26 | Ga0466709_161236 | 3300042648 | Bacteria | 2826 |
| 27 | Ga0466727_150038 | 3300042655 | Bacteria | 31765 |
| 28 | Ga0466690_023688 | 3300042590 | Bacteria | 3421 |
| 29 | Ga0466692_175785 | 3300042591 | Bacteria | 2210 |
| 30 | Ga0466696_177837 | 3300042596 | Bacteria | 4787 |
| 31 | Ga0466696_470029 | 3300042596 | Bacteria | 3443 |
| 32 | Ga0466715_575991 | 3300042616 | Bacteria | 10831 |
| 33 | Ga0123357_10065228 | 3300009784 | Bacteria | 4862 |
| 34 | Ga0123357_10564196 | 3300009784 | Unclassified | 898 |
| 35 | Ga0123355_11397979 | 3300009826 | Unclassified | 692 |
| 36 | Ga0123356_13954292 | 3300010049 | Bacteria | 511 |
| 37 | Ga0466707_104078 | 3300042601 | Bacteria | 25332 |
| 38 | Ga0466707_166229 | 3300042601 | Bacteria | 2781 |
| 39 | Ga0466707_187619 | 3300042601 | Bacteria | 4106 |
| 40 | Ga0466716_442881 | 3300042605 | Bacteria | 4209 |
| 41 | 2227490470 | 2225789004 | Bacteria | 4107 |
| 42 | IMNBL1DRAFT_c0076186 | 3300000062 | Bacteria | 952 |
| 43 | Ga0466729_211367 | 3300042621 | Bacteria | 16775 |
| 44 | Ga0466735_113850 | 3300042624 | Bacteria | 1023 |
| 45 | Ga0466703_129408 | 3300042636 | Bacteria | 2749 |
| 46 | Ga0466704_479629 | 3300042643 | Bacteria | 9360 |
| 47 | Ga0466727_105531 | 3300042655 | Bacteria | 3760 |
| 48 | Ga0466697_278910 | 3300042611 | Bacteria | 1881 |
| 49 | Ga0466705_225484 | 3300042612 | Bacteria | 1401 |
| 50 | Ga0466705_237773 | 3300042612 | Bacteria | 1889 |
| 51 | Ga0466705_383225 | 3300042612 | Unclassified | 2255 |
| 52 | Ga0466732_326244 | 3300042656 | Bacteria | 1493 |
| 53 | Ga0466691_039043 | 3300042593 | Bacteria | 7947 |
| 54 | Ga0466729_026668 | 3300042621 | Bacteria | 1145 |
| 55 | Ga0123357_10176755 | 3300009784 | Bacteria | 2507 |
| 56 | Ga0123356_11158353 | 3300010049 | Unclassified | 940 |
| 57 | Ga0123353_11615124 | 3300010167 | Bacteria | 818 |
| 58 | Ga0466701_084460 | 3300042598 | Bacteria | 6172 |
| 59 | Ga0466700_460532 | 3300042600 | Bacteria | 2660 |
| 60 | Ga0466707_095237 | 3300042601 | Bacteria | 13588 |
| 61 | Ga0466713_017127 | 3300042602 | Bacteria | 94881 |
| 62 | Ga0466719_536370 | 3300042606 | Bacteria | 1581 |
| 63 | 2227652406 | 2225789004 | Bacteria | 10729 |
| 64 | Ga0123357_10000458 | 3300009784 | Bacteria | 39494 |
| 65 | Ga0466704_160374 | 3300042643 | Bacteria | 25736 |
| 66 | Ga0466704_261304 | 3300042643 | Bacteria | 8340 |
| 67 | Ga0466733_073404 | 3300042659 | Bacteria | 15391 |
| 68 | Ga0466692_107303 | 3300042591 | Bacteria | 3729 |
| 69 | Ga0466692_148899 | 3300042591 | Bacteria | 16099 |
| 70 | Ga0466696_175454 | 3300042596 | Bacteria | 1744 |
| 71 | Ga0466701_000462 | 3300042598 | Bacteria | 39838 |
| 72 | Ga0466705_511066 | 3300042612 | Bacteria | 20427 |
| 73 | Ga0466710_353571 | 3300042613 | Bacteria | 1345 |
| 74 | Ga0466710_396579 | 3300042613 | Bacteria | 9148 |
| 75 | Ga0123357_10614462 | 3300009784 | Bacteria | 826 |
| 76 | Ga0123356_10978059 | 3300010049 | Bacteria | 1017 |
| 77 | Ga0123353_10883878 | 3300010167 | Bacteria | 1219 |
| 78 | Ga0123354_10541656 | 3300010882 | Bacteria | 883 |
| 79 | Ga0466707_075198 | 3300042601 | Bacteria | 13033 |
| 80 | Ga0466707_324992 | 3300042601 | Bacteria | 1339 |
| 81 | Ga0466719_437134 | 3300042606 | Bacteria | 3747 |
| 82 | Ga0466697_056567 | 3300042611 | Bacteria | 485126 |
| 83 | 2227375261 | 2225789004 | Bacteria | 5968 |
| 84 | IMNBL1DRAFT_c0004089 | 3300000062 | Bacteria | 8920 |
| 85 | JGI24702J35022_10015686 | 3300002462 | Bacteria | 4162 |
| 86 | JGI24702J35022_10058789 | 3300002462 | Bacteria | 2053 |
| 87 | JGI24702J35022_10199042 | 3300002462 | Unclassified | 1145 |
| 88 | JGI24696J40584_12451564 | 3300002834 | Bacteria | 576 |
| 89 | Ga0466703_028163 | 3300042636 | Bacteria | 5109 |
| 90 | Ga0466703_084851 | 3300042636 | Bacteria | 16965 |
| 91 | Ga0466704_186547 | 3300042643 | Bacteria | 9429 |
| 92 | Ga0466704_470276 | 3300042643 | Bacteria | 10510 |
| 93 | Ga0466708_270810 | 3300042652 | Bacteria | 3487 |
| 94 | Ga0466705_052705 | 3300042612 | Bacteria | 20164 |
| 95 | Ga0466705_133981 | 3300042612 | Bacteria | 5258 |
| 96 | Ga0466705_263821 | 3300042612 | Bacteria | 21616 |
| 97 | Ga0466732_248561 | 3300042656 | Unclassified | 1785 |
| 98 | Ga0466733_110450 | 3300042659 | Bacteria | 40709 |
| 99 | Ga0466657_348316 | 3300042582 | Unclassified | 1243 |
| 100 | Ga0466694_194721 | 3300042594 | Bacteria | 3074 |
| 101 | Ga0466723_005954 | 3300042618 | Bacteria | 4147 |
| 102 | Ga0466726_288887 | 3300042619 | Bacteria | 17570 |
| 103 | Ga0466728_169887 | 3300042620 | Bacteria | 3816 |
| 104 | Ga0123356_10083626 | 3300010049 | Bacteria | 3024 |
| 105 | Ga0123356_11342504 | 3300010049 | Unclassified | 877 |
| 106 | Ga0123354_10814852 | 3300010882 | Unclassified | 626 |
| 107 | Ga0466713_067215 | 3300042602 | Bacteria | 23216 |
| 108 | Ga0466713_151474 | 3300042602 | Bacteria | 1643 |
| 109 | IMNBL1DRAFT_c0001092 | 3300000062 | Bacteria | 20800 |
| 110 | JGI24702J35022_10139950 | 3300002462 | Bacteria | 1350 |
| 111 | Ga0466703_132722 | 3300042636 | Bacteria | 1786 |
| 112 | Ga0466727_196033 | 3300042655 | Bacteria | 6068 |
| 113 | Ga0466705_415721 | 3300042612 | Unclassified | 2227 |
| 114 | Ga0466715_364671 | 3300042616 | Bacteria | 20378 |
| 115 | Ga0123357_10035183 | 3300009784 | Bacteria | 6809 |
| 116 | Ga0123357_10575928 | 3300009784 | Bacteria | 880 |
| 117 | Ga0123353_12363204 | 3300010167 | Bacteria | 637 |
| 118 | Ga0123354_10001525 | 3300010882 | Bacteria | 28373 |
| 119 | Ga0466707_386769 | 3300042601 | Bacteria | 1074 |
| 120 | Ga0466713_017181 | 3300042602 | Bacteria | 54753 |
| 121 | Ga0466713_020857 | 3300042602 | Bacteria | 6155 |
| 122 | Ga0466719_110688 | 3300042606 | Bacteria | 18844 |
| 123 | Ga0466722_153270 | 3300042609 | Bacteria | 1719 |
| 124 | IMNBL1DRAFT_c0004191 | 3300000062 | Bacteria | 8766 |
| 125 | Ga0466735_164016 | 3300042624 | Bacteria | 2807 |
| 126 | Ga0466704_299516 | 3300042643 | Bacteria | 6618 |
| 127 | Ga0466725_000988 | 3300042654 | Bacteria | 1466 |
| 128 | Ga0466727_231918 | 3300042655 | Bacteria | 5807 |
| 129 | Ga0466733_030455 | 3300042659 | Bacteria | 39544 |
| 130 | Ga0466733_032300 | 3300042659 | Unclassified | 5543 |
| 131 | Ga0466733_093605 | 3300042659 | Bacteria | 59912 |
| 132 | Ga0265387_1008290 | 3300024582 | Bacteria | 1396 |
| 133 | Ga0466715_542362 | 3300042616 | Bacteria | 1222 |
| 134 | Ga0466726_070488 | 3300042619 | Unclassified | 1478 |
| 135 | Ga0466729_181930 | 3300042621 | Bacteria | 1139 |
| 136 | Ga0123353_10136356 | 3300010167 | Bacteria | 3936 |
| 137 | Ga0123354_10010911 | 3300010882 | Bacteria | 14018 |
| 138 | Ga0123354_10027171 | 3300010882 | Bacteria | 9016 |
| 139 | Ga0123354_10210133 | 3300010882 | Unclassified | 2106 |
| 140 | Ga0123354_10259209 | 3300010882 | Unclassified | 1741 |
| 141 | Ga0123354_10833085 | 3300010882 | Bacteria | 616 |
| 142 | Ga0466706_073522 | 3300042599 | Bacteria | 4327 |
| 143 | Ga0466713_104757 | 3300042602 | Bacteria | 74823 |
| 144 | Ga0466716_083754 | 3300042605 | Bacteria | 2026 |
| 145 | Ga0466722_118767 | 3300042609 | Bacteria | 13208 |
| 146 | 2227239117 | 2225789004 | Bacteria | 7263 |
| 147 | Ga0123357_10000085 | 3300009784 | Bacteria | 75372 |
| 148 | Ga0466703_032512 | 3300042636 | Bacteria | 2281 |
| 149 | Ga0466703_033062 | 3300042636 | Bacteria | 4323 |
| 150 | Ga0466703_411849 | 3300042636 | Bacteria | 1181 |
| 151 | Ga0466704_591639 | 3300042643 | Unclassified | 1607 |
| 152 | Ga0466727_112062 | 3300042655 | Bacteria | 11250 |
| 153 | Ga0466657_098958 | 3300042582 | Bacteria | 1008 |
| 154 | Ga0466693_311047 | 3300042592 | Bacteria | 1190 |
| 155 | Ga0466695_120949 | 3300042595 | Bacteria | 2766 |
| 156 | Ga0466711_022845 | 3300042615 | Bacteria | 2082 |
| 157 | Ga0466711_206391 | 3300042615 | Bacteria | 7473 |
| 158 | Ga0466726_082467 | 3300042619 | Bacteria | 2903 |
| 159 | Ga0466729_194629 | 3300042621 | Unclassified | 1052 |
| 160 | Ga0123357_10048629 | 3300009784 | Unclassified | 5746 |
| 161 | Ga0123357_10079202 | 3300009784 | Unclassified | 4327 |
| 162 | Ga0123356_13388983 | 3300010049 | Bacteria | 553 |
| 163 | Ga0123353_12932419 | 3300010167 | Unclassified | 555 |
| 164 | Ga0123354_10073719 | 3300010882 | Unclassified | 4898 |
| 165 | Ga0123354_10161558 | 3300010882 | Bacteria | 2657 |
| 166 | Ga0466700_465810 | 3300042600 | Unclassified | 8510 |
| 167 | Ga0466716_034468 | 3300042605 | Unclassified | 5214 |
| 168 | IMNBL1DRAFT_c0064429 | 3300000062 | Bacteria | 1085 |
| 169 | JGI24705J35276_11785396 | 3300002504 | Unclassified | 676 |
| 170 | JGI24699J35502_11134134 | 3300002509 | Bacteria | 35214 |
| 171 | Ga0068305_10281614 | 3300005083 | Unclassified | 3982 |
| 172 | Ga0466731_348241 | 3300042622 | Unclassified | 2348 |
| 173 | Ga0466735_137142 | 3300042624 | Bacteria | 1436 |
| 174 | Ga0466730_086184 | 3300042625 | Unclassified | 6468 |
| 175 | Ga0466703_321983 | 3300042636 | Bacteria | 6631 |
| 176 | Ga0466703_414764 | 3300042636 | Unclassified | 3659 |
| 177 | Ga0466704_164916 | 3300042643 | Bacteria | 14920 |
| 178 | Ga0466709_164171 | 3300042648 | Bacteria | 70343 |
| 179 | Ga0466708_432797 | 3300042652 | Bacteria | 1777 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03965 | Penicillinase_R | Penicillinase repressor | 10 | 123 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.