Protein Family IF09058
Metagenome
Isolate
129
Members
71
Samples
104
Scaffolds
241.84
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_239362|Ga0466702_239362_598_1404
- Length
- 268 aa
- Sequence
- MPPHGGIKQKSDEEHEERRVYMDYRNSVEFSVKGDCALFSDPVTRVGGEKCSYHIPTYEALKGILHSVYWKPTIVWDIDKVRVMNQIQTATQNVRPIDYNNDGNDLAIYTYLRDVHYQVKAHFDWNYNRPELLPDRNEHKHHNIAKRMISRGGRRDIFLGTRECQGYVEPCAFGEGNGFYDGMPELAFGYMFHGFTYADEAVREEEKMKLSVRFFRPVMRKGVVSFPLPEECGEKDRRIIRDFPIKSFGEGNFVGLAEFAQGAGGADL
Sample Types
Isolate
19.4%
Metagenome
80.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.9%
Kalotermitidae
19.1%
Apidae
16.2%
Unclassified
8.8%
Tenebrionidae
5.9%
Scarabaeidae
4.4%
Termopsidae
4.4%
Passalidae
2.9%
Rhinotermitidae
2.9%
Hodotermitidae
1.5%
Bombycidae
1.5%
Libellulidae
1.5%
Noctuidae
1.5%
Blattidae
1.5%
Taxonomy
Archaea
2
Bacteria
120
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 4 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 5 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 8 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 9 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 10 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 13 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 17 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 18 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 19 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 28 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 29 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 30 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 31 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 32 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 33 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 34 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 40 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 41 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 42 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 47 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 50 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 51 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 52 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 53 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 54 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 55 | 2940228231 | Anaerovoracaceae bacterium PM5-7 | Isolate | Blattidae |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 60 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 61 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 62 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 63 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 64 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 65 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 66 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 67 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 68 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562375_0018 | 3300056856 | Bacteria | 940838 |
| 2 | Ga0466707_239214 | 3300042601 | Bacteria | 1275 |
| 3 | Ga0466713_064266 | 3300042602 | Unclassified | 2278 |
| 4 | Ga0466698_096028 | 3300042610 | Bacteria | 7374 |
| 5 | Ga0123357_10026727 | 3300009784 | Unclassified | 7794 |
| 6 | Ga0123356_10020109 | 3300010049 | Bacteria | 6323 |
| 7 | Ga0123354_10153035 | 3300010882 | Bacteria | 2783 |
| 8 | Ga0466690_061637 | 3300042590 | Bacteria | 4298 |
| 9 | Ga0466693_227140 | 3300042592 | Bacteria | 2157 |
| 10 | Ga0466734_002632 | 3300042623 | Bacteria | 4671 |
| 11 | Ga0466703_219754 | 3300042636 | Bacteria | 56946 |
| 12 | Ga0466708_262036 | 3300042652 | Bacteria | 12041 |
| 13 | Ga0466726_452863 | 3300042619 | Bacteria | 6293 |
| 14 | Ga0530661_000547 | 3300056564 | Bacteria | 26314 |
| 15 | Ga0466706_137482 | 3300042599 | Bacteria | 1705 |
| 16 | Ga0466700_046155 | 3300042600 | Bacteria | 2550 |
| 17 | Ga0466707_233193 | 3300042601 | Bacteria | 9404 |
| 18 | Ga0466714_018776 | 3300042603 | Bacteria | 9947 |
| 19 | Ga0466722_047851 | 3300042609 | Bacteria | 49648 |
| 20 | Ga0123356_10047050 | 3300010049 | Bacteria | 4014 |
| 21 | Ga0123356_10086449 | 3300010049 | Bacteria | 2976 |
| 22 | Ga0123354_10263511 | 3300010882 | Bacteria | 1715 |
| 23 | IMNBL1DRAFT_c0000717 | 3300000062 | Bacteria | 26446 |
| 24 | IMNBL1DRAFT_c0001959 | 3300000062 | Bacteria | 14829 |
| 25 | JGI24696J40584_12778140 | 3300002834 | Bacteria | 832 |
| 26 | Ga0466702_239362 | 3300042635 | Bacteria | 1559 |
| 27 | Ga0466703_406126 | 3300042636 | Bacteria | 1556 |
| 28 | Ga0466715_101664 | 3300042616 | Bacteria | 3975 |
| 29 | Ga0466718_132366 | 3300042617 | Bacteria | 24100 |
| 30 | Ga0562375_0118 | 3300056856 | Bacteria | 236233 |
| 31 | Ga0466706_052335 | 3300042599 | Bacteria | 10688 |
| 32 | Ga0123353_10035666 | 3300010167 | Bacteria | 7780 |
| 33 | Ga0123354_10293180 | 3300010882 | Bacteria | 1554 |
| 34 | JGI24702J35022_10320221 | 3300002462 | Bacteria | 920 |
| 35 | JGI24705J35276_12188508 | 3300002504 | Bacteria | 1441 |
| 36 | JGI24705J35276_12237668 | 3300002504 | Bacteria | 12417 |
| 37 | Ga0466691_188157 | 3300042593 | Bacteria | 14175 |
| 38 | Ga0466729_213371 | 3300042621 | Bacteria | 4303 |
| 39 | Ga0466704_466603 | 3300042643 | Bacteria | 1019 |
| 40 | Ga0466711_082375 | 3300042615 | Bacteria | 9598 |
| 41 | Ga0466715_031469 | 3300042616 | Bacteria | 7002 |
| 42 | Ga0466715_044661 | 3300042616 | Bacteria | 3498 |
| 43 | Ga0466715_045581 | 3300042616 | Bacteria | 16064 |
| 44 | Ga0466714_030748 | 3300042603 | Bacteria | 21529 |
| 45 | Ga0466714_093722 | 3300042603 | Bacteria | 1552 |
| 46 | Ga0123355_10000364 | 3300009826 | Bacteria | 58670 |
| 47 | Ga0123355_10124824 | 3300009826 | Bacteria | 3981 |
| 48 | Ga0123353_10147298 | 3300010167 | Bacteria | 3763 |
| 49 | Ga0466708_129204 | 3300042652 | Bacteria | 3781 |
| 50 | Ga0466711_110937 | 3300042615 | Bacteria | 4781 |
| 51 | Ga0466715_296460 | 3300042616 | Bacteria | 2544 |
| 52 | Ga0466726_057928 | 3300042619 | Archaea | 22876 |
| 53 | Ga0530661_002377 | 3300056564 | Bacteria | 7180 |
| 54 | Ga0562374_0565 | 3300057007 | Unclassified | 59401 |
| 55 | Ga0466706_103383 | 3300042599 | Bacteria | 3073 |
| 56 | Ga0123355_10025775 | 3300009826 | Bacteria | 9470 |
| 57 | Ga0123353_10322480 | 3300010167 | Bacteria | 2343 |
| 58 | Ga0123353_11051442 | 3300010167 | Bacteria | 1087 |
| 59 | Ga0123353_11354364 | 3300010167 | Bacteria | 919 |
| 60 | Ga0123354_10291122 | 3300010882 | Bacteria | 1565 |
| 61 | 2227496852 | 2225789004 | Bacteria | 19894 |
| 62 | JGI24702J35022_10144983 | 3300002462 | Bacteria | 1328 |
| 63 | Ga0068302_10070142 | 3300005071 | Unclassified | 4836 |
| 64 | Ga0466735_164414 | 3300042624 | Unclassified | 1086 |
| 65 | Ga0466704_249649 | 3300042643 | Bacteria | 11970 |
| 66 | Ga0466708_240919 | 3300042652 | Bacteria | 39444 |
| 67 | Ga0466733_120828 | 3300042659 | Bacteria | 3118 |
| 68 | Ga0466707_143114 | 3300042601 | Bacteria | 1731 |
| 69 | Ga0123355_10007403 | 3300009826 | Bacteria | 16442 |
| 70 | Ga0123353_10000332 | 3300010167 | Bacteria | 58261 |
| 71 | Ga0123353_11422971 | 3300010167 | Bacteria | 889 |
| 72 | IMNBL1DRAFT_c0002233 | 3300000062 | Bacteria | 13657 |
| 73 | Ga0466704_428567 | 3300042643 | Bacteria | 7849 |
| 74 | Ga0466709_100720 | 3300042648 | Bacteria | 19504 |
| 75 | Ga0466715_621324 | 3300042616 | Bacteria | 2876 |
| 76 | Ga0530661_000027 | 3300056564 | Bacteria | 177246 |
| 77 | Ga0530661_002110 | 3300056564 | Unclassified | 8084 |
| 78 | Ga0466707_075174 | 3300042601 | Bacteria | 159565 |
| 79 | Ga0466719_405979 | 3300042606 | Bacteria | 1354 |
| 80 | Ga0123355_10199929 | 3300009826 | Bacteria | 2922 |
| 81 | Ga0160452_100291 | 3300012834 | Bacteria | 46805 |
| 82 | Ga0466694_135302 | 3300042594 | Bacteria | 2869 |
| 83 | Ga0466735_085784 | 3300042624 | Bacteria | 5130 |
| 84 | Ga0466703_255005 | 3300042636 | Bacteria | 1463 |
| 85 | Ga0466708_379484 | 3300042652 | Bacteria | 12028 |
| 86 | Ga0466705_519925 | 3300042612 | Bacteria | 55786 |
| 87 | Ga0466711_307281 | 3300042615 | Bacteria | 12437 |
| 88 | Ga0466715_180208 | 3300042616 | Bacteria | 9225 |
| 89 | Ga0466726_004082 | 3300042619 | Bacteria | 10861 |
| 90 | Ga0466726_422686 | 3300042619 | Bacteria | 2111 |
| 91 | Ga0466728_040320 | 3300042620 | Bacteria | 5277 |
| 92 | Ga0466733_146375 | 3300042659 | Bacteria | 9726 |
| 93 | Ga0123353_10084459 | 3300010167 | Unclassified | 5111 |
| 94 | IMNBL1DRAFT_c0000342 | 3300000062 | Archaea | 39457 |
| 95 | IMNBL1DRAFT_c0005259 | 3300000062 | Bacteria | 7466 |
| 96 | IMNBL1DRAFT_c0006000 | 3300000062 | Bacteria | 6776 |
| 97 | Ga0265387_1001246 | 3300024582 | Bacteria | 3750 |
| 98 | Ga0466696_203476 | 3300042596 | Bacteria | 1767 |
| 99 | Ga0466729_213213 | 3300042621 | Bacteria | 3643 |
| 100 | Ga0466704_298697 | 3300042643 | Bacteria | 7053 |
| 101 | Ga0466704_335107 | 3300042643 | Bacteria | 8888 |
| 102 | Ga0466712_074731 | 3300042614 | Bacteria | 6849 |
| 103 | Ga0466711_016730 | 3300042615 | Bacteria | 1445 |
| 104 | Ga0466723_028079 | 3300042618 | Bacteria | 1449 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09704 | Cas_Cas5d | CRISPR-associated protein (Cas_Cas5) | 28 | 226 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF09704 | GO:0043571 | maintenance of CRISPR repeat elements | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.