Protein Family IF09057
Metagenome
Isolate
479
Members
306
Samples
224
Scaffolds
37.29
Avg Length
Representative Sequence
- ID
- 3300042635|Ga0466702_238106|Ga0466702_238106_274_414
- Length
- 46 aa
- Sequence
- MKVRRIPLVMKVRPSVKPMCEKCKIIKRKGKVMVICINPKHKQRQG
Sample Types
Isolate
53.2%
Metagenome
46.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
33.8%
Ixodidae
28.5%
Termitidae
6.6%
Apidae
5.0%
Kalotermitidae
4.6%
Blattidae
3.0%
Scarabaeidae
2.0%
Elmidae
2.0%
Pyralidae
1.7%
Argasidae
1.3%
Tenebrionidae
1.3%
Drosophilidae
1.0%
Passalidae
1.0%
Termopsidae
1.0%
Rhinotermitidae
0.7%
Bombycidae
0.7%
Dytiscidae
0.7%
Culicidae
0.7%
Noctuidae
0.7%
Calliphoridae
0.3%
Vespidae
0.3%
Hodotermitidae
0.3%
Formicidae
0.3%
Nephropidae
0.3%
Ocypodidae
0.3%
Armadillidiidae
0.3%
Penaeidae
0.3%
Portunidae
0.3%
Cerambycidae
0.3%
Hydrophilidae
0.3%
Eresidae
0.3%
Taxonomy
Archaea
0
Bacteria
457
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 2 | 2731957996 | Borreliella burgdorferi IPT141 | Isolate | Ixodidae |
| 3 | 2734482045 | Borreliella burgdorferi IPT26 | Isolate | Ixodidae |
| 4 | 2734482058 | Borreliella burgdorferi IPT93 | Isolate | Ixodidae |
| 5 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 6 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 7 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 8 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 9 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 10 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 11 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 12 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 13 | 2820560510 | Unclassified Firmicutes Emb289P3bin72 | Isolate | Unclassified |
| 14 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 15 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 16 | 8114010755 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 17 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 18 | 2857309358 | Borreliella burgdorferi Bb16-193-2 | Isolate | Ixodidae |
| 19 | 2858961961 | Borreliella burgdorferi Bb16-87 | Isolate | Ixodidae |
| 20 | 2858965870 | Borreliella burgdorferi Bb16-186 | Isolate | Ixodidae |
| 21 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 22 | 2871349079 | Borreliella burgdorferi Bb16-15-2 | Isolate | Ixodidae |
| 23 | 2871354325 | Borreliella burgdorferi Bb16-60-1 | Isolate | Ixodidae |
| 24 | 2874015014 | Borreliella burgdorferi Bb16-74-1 | Isolate | Ixodidae |
| 25 | 2878663248 | Borreliella burgdorferi Bb16-93 | Isolate | Ixodidae |
| 26 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 27 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 28 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 29 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 32 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 35 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 40 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 41 | 2734482043 | Borreliella burgdorferi IPT2 | Isolate | Ixodidae |
| 42 | 2734482049 | Borreliella burgdorferi IPT48 | Isolate | Ixodidae |
| 43 | 2734482052 | Borreliella burgdorferi IPT61 | Isolate | Ixodidae |
| 44 | 2734482053 | Borreliella burgdorferi IPT69 | Isolate | Ixodidae |
| 45 | 2734482059 | Borreliella burgdorferi IPT112 | Isolate | Ixodidae |
| 46 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 47 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 48 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 49 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 50 | 2791354849 | Unclassified Chloroflexi Lab288P3bin29 | Isolate | Unclassified |
| 51 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 52 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 53 | 2820339298 | Unclassified Firmicutes Nt197P3bin68 | Isolate | Unclassified |
| 54 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 55 | 2820546020 | Unclassified Firmicutes Lab288P1bin102 | Isolate | Unclassified |
| 56 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 57 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 58 | 2775507261 | Borrelia turicatae 91E135 | Isolate | Argasidae |
| 59 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 60 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 61 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 62 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 63 | 2857306702 | Borreliella burgdorferi Bb16-139 | Isolate | Ixodidae |
| 64 | 2858964532 | Borreliella burgdorferi Bb16-111 | Isolate | Ixodidae |
| 65 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 66 | 2869084697 | Borreliella burgdorferi Bb16-182 | Isolate | Ixodidae |
| 67 | 2871346306 | Borreliella burgdorferi FDAARGOS_196 | Isolate | Unclassified |
| 68 | 2871356981 | Borreliella burgdorferi Bb16-62 | Isolate | Ixodidae |
| 69 | 2871358293 | Borreliella burgdorferi Bb16-149 | Isolate | Ixodidae |
| 70 | 2878668649 | Borreliella burgdorferi Bb16-10-2 | Isolate | Ixodidae |
| 71 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 72 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 73 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 74 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 75 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 76 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 77 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 78 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 79 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 80 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 81 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 82 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 83 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 84 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 85 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 86 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 87 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 88 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 89 | 2734482051 | Borreliella burgdorferi IPT60 | Isolate | Ixodidae |
| 90 | 2734482055 | Borreliella burgdorferi IPT71 | Isolate | Ixodidae |
| 91 | 2734482061 | Borreliella burgdorferi IPT137 | Isolate | Ixodidae |
| 92 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 93 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 94 | 2820525019 | Unclassified Firmicutes Lab288P1bin2 | Isolate | Unclassified |
| 95 | 2820570671 | Unclassified Firmicutes Emb289P3bin19 | Isolate | Unclassified |
| 96 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 97 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 98 | 2820639607 | Unclassified Firmicutes Cu122P5bin9 | Isolate | Unclassified |
| 99 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 100 | 2871353019 | Borreliella burgdorferi Bb16-23-2 | Isolate | Ixodidae |
| 101 | 2874019019 | Borreliella burgdorferi Bb16-178-1 | Isolate | Ixodidae |
| 102 | 2876286789 | Borreliella burgdorferi Bb16-57-1 | Isolate | Ixodidae |
| 103 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 104 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 105 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 106 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 107 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 108 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 109 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 110 | 2684622825 | Borreliella burgdorferi IPT132 | Isolate | Ixodidae |
| 111 | 2734482047 | Borreliella burgdorferi IPT35 | Isolate | Ixodidae |
| 112 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 113 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 114 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 115 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 116 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 117 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 118 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 119 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 120 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 121 | 2820520043 | Unclassified Firmicutes Lab288P1bin24 | Isolate | Unclassified |
| 122 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 123 | 2858963232 | Borreliella burgdorferi Bb16-138 | Isolate | Ixodidae |
| 124 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 125 | 2871351682 | Borreliella burgdorferi Bb16-71-2 | Isolate | Ixodidae |
| 126 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 127 | 2874021675 | Borreliella burgdorferi Bb16-22-2 | Isolate | Ixodidae |
| 128 | 2876289390 | Borreliella burgdorferi Bb16-181 | Isolate | Ixodidae |
| 129 | 2876290715 | Borreliella burgdorferi Bb16-249 | Isolate | Ixodidae |
| 130 | 2878665935 | Borreliella burgdorferi Bb16-54 | Isolate | Ixodidae |
| 131 | 2878667283 | Borreliella burgdorferi Bb16-170 | Isolate | Ixodidae |
| 132 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 133 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 134 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 135 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 136 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 137 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 138 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 139 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 140 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 141 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 142 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 143 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 144 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 145 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 146 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 147 | 2545555866 | Borrelia coriaceae ATCC 43381 | Isolate | Argasidae |
| 148 | 2684622829 | Borreliella burgdorferi IPT49 | Isolate | Ixodidae |
| 149 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 150 | 2734482042 | Borreliella burgdorferi IPT19 | Isolate | Ixodidae |
| 151 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 152 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 153 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 154 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 155 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 156 | 2820318056 | Unclassified Firmicutes Nt197P3bin94 | Isolate | Unclassified |
| 157 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 158 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 159 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 160 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 161 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 162 | 2855879212 | Borreliella burgdorferi Bb16-105 | Isolate | Ixodidae |
| 163 | 2855886268 | Borreliella burgdorferi Bb16-49 | Isolate | Ixodidae |
| 164 | 2858959297 | Borreliella burgdorferi Bb16-110 | Isolate | Ixodidae |
| 165 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 166 | 2869075452 | Borreliella burgdorferi Bb16-163 | Isolate | Ixodidae |
| 167 | 2869076876 | Borreliella burgdorferi Bb16-130 | Isolate | Ixodidae |
| 168 | 2869078160 | Borreliella burgdorferi Bb16-132 | Isolate | Ixodidae |
| 169 | 2869080807 | Borreliella burgdorferi Bb16-145 | Isolate | Ixodidae |
| 170 | 2874023042 | Borreliella burgdorferi Bb16-164 | Isolate | Ixodidae |
| 171 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 172 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 173 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 174 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 175 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 176 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 177 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 178 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 179 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 180 | 2684622824 | Borreliella burgdorferi IPT92 | Isolate | Ixodidae |
| 181 | 2734482044 | Borreliella burgdorferi IPT23 | Isolate | Ixodidae |
| 182 | 2734482057 | Borreliella burgdorferi IPT87 | Isolate | Ixodidae |
| 183 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 184 | 2820257794 | Unclassified Firmicutes Th196P3bin47 | Isolate | Unclassified |
| 185 | 2820261600 | Unclassified Firmicutes Th196P3bin40 | Isolate | Unclassified |
| 186 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 187 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 188 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 189 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 190 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 191 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 192 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 193 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 194 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 195 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 196 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 197 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 198 | 2857308017 | Borreliella burgdorferi Bb16-47 | Isolate | Ixodidae |
| 199 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 200 | 2869083384 | Borreliella burgdorferi Bb16-17-1 | Isolate | Ixodidae |
| 201 | 2869087424 | Borreliella burgdorferi Bb16-174 | Isolate | Ixodidae |
| 202 | 2874020406 | Borreliella burgdorferi Bb16-268 | Isolate | Ixodidae |
| 203 | 2874025758 | Borreliella burgdorferi Bb16-85 | Isolate | Ixodidae |
| 204 | 2876281384 | Borreliella burgdorferi Bb16-66 | Isolate | Ixodidae |
| 205 | 2876282676 | Borreliella burgdorferi Bb16-167 | Isolate | Ixodidae |
| 206 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 207 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 208 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 209 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 210 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 211 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 212 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 213 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 214 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 215 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 216 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 217 | 2565956565 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 218 | 2684622828 | Borreliella burgdorferi IPT24 | Isolate | Ixodidae |
| 219 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 220 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 221 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 222 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 223 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 224 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 225 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 226 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 227 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 228 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 229 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 230 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 231 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 232 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 233 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 234 | 2820569216 | Unclassified Firmicutes Emb289P3bin33 | Isolate | Unclassified |
| 235 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 236 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 237 | 2848247722 | Borreliella burgdorferi Bb16-178-2 | Isolate | Ixodidae |
| 238 | 2848601500 | Borreliella burgdorferi B31_NRZ/B31 | Isolate | Unclassified |
| 239 | 2855880528 | Borreliella burgdorferi Bb16-142 | Isolate | Ixodidae |
| 240 | 2855884914 | Borreliella burgdorferi Bb16-188 | Isolate | Ixodidae |
| 241 | 2858968553 | Borreliella burgdorferi Bb16-55-1 | Isolate | Ixodidae |
| 242 | 2858969863 | Borreliella burgdorferi Bb16-136 | Isolate | Ixodidae |
| 243 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 244 | 2869079483 | Borreliella burgdorferi Bb16-90-2 | Isolate | Ixodidae |
| 245 | 2869082144 | Borreliella burgdorferi Bb16-33-3 | Isolate | Ixodidae |
| 246 | 2871347738 | Borreliella burgdorferi Bb16-150 | Isolate | Ixodidae |
| 247 | 2871355664 | Borreliella burgdorferi Bb16-133 | Isolate | Ixodidae |
| 248 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 249 | 2874024451 | Borreliella burgdorferi Bb16-250 | Isolate | Ixodidae |
| 250 | 2876278714 | Borreliella burgdorferi Bb16-80 | Isolate | Ixodidae |
| 251 | 2876288115 | Borreliella burgdorferi Bb16-16-1 | Isolate | Ixodidae |
| 252 | 2878664590 | Borreliella burgdorferi Bb16-146 | Isolate | Ixodidae |
| 253 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 254 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 255 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 256 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 257 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 258 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 259 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 260 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 261 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 262 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 263 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 264 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 265 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 266 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 267 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 268 | 2562617164 | Borreliella finlandensis SV1 | Isolate | Unclassified |
| 269 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 270 | 2734482050 | Borreliella burgdorferi IPT51 | Isolate | Ixodidae |
| 271 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 272 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 273 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 274 | 2820231849 | Unclassified Firmicutes Th196P4bin1 | Isolate | Unclassified |
| 275 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 276 | 2820360414 | Unclassified Firmicutes Nt197P3bin121 | Isolate | Unclassified |
| 277 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 278 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 279 | 2820438595 | Unclassified Firmicutes Lab288P3bin208 | Isolate | Unclassified |
| 280 | 2511231103 | Borreliella bissettii DN127 | Isolate | Ixodidae |
| 281 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 282 | 2834746962 | Borreliella burgdorferi Bb16-59-1 | Isolate | Ixodidae |
| 283 | 2855883528 | Borreliella burgdorferi Bb16-184 | Isolate | Ixodidae |
| 284 | 2857305381 | Borreliella burgdorferi Bb16-135 | Isolate | Ixodidae |
| 285 | 2858960593 | Borreliella burgdorferi Bb16-175 | Isolate | Ixodidae |
| 286 | 2858967205 | Borreliella burgdorferi Bb16-183 | Isolate | Ixodidae |
| 287 | 2869086051 | Borreliella burgdorferi Bb16-122 | Isolate | Ixodidae |
| 288 | 2871350378 | Borreliella burgdorferi Bb16-52 | Isolate | Ixodidae |
| 289 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 290 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 291 | 2874016390 | Borreliella burgdorferi Bb16-134 | Isolate | Ixodidae |
| 292 | 2874017695 | Borreliella burgdorferi Bb16-128 | Isolate | Ixodidae |
| 293 | 2874027102 | Borreliella burgdorferi Bb16-112 | Isolate | Ixodidae |
| 294 | 2876280065 | Borreliella burgdorferi Bb16-126 | Isolate | Ixodidae |
| 295 | 2876284025 | Borreliella burgdorferi Bb16-202 | Isolate | Ixodidae |
| 296 | 2876285412 | Borreliella burgdorferi Bb16-198 | Isolate | Ixodidae |
| 297 | 2881226535 | Candidatus Borreliella tachyglossi Bc-F10-1268 | Isolate | Ixodidae |
| 298 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 299 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 300 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 301 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 302 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 303 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 304 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 305 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 306 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466693_092334 | 3300042592 | Bacteria | 2074 |
| 2 | Ga0466702_015895 | 3300042635 | Bacteria | 1692 |
| 3 | Ga0466702_180988 | 3300042635 | Bacteria | 12693 |
| 4 | Ga0466727_280896 | 3300042655 | Bacteria | 3189 |
| 5 | Ga0466706_279526 | 3300042599 | Bacteria | 1022 |
| 6 | Ga0466707_289453 | 3300042601 | Bacteria | 1407 |
| 7 | Ga0466714_073998 | 3300042603 | Bacteria | 2469 |
| 8 | Ga0123357_10014507 | 3300009784 | Bacteria | 10289 |
| 9 | Ga0123355_10005165 | 3300009826 | Bacteria | 19051 |
| 10 | Ga0123355_10021397 | 3300009826 | Bacteria | 10348 |
| 11 | Ga0123355_10033096 | 3300009826 | Bacteria | 8393 |
| 12 | Ga0123356_10912048 | 3300010049 | Bacteria | 1050 |
| 13 | Ga0123353_10042873 | 3300010167 | Bacteria | 7161 |
| 14 | Ga0123353_10062630 | 3300010167 | Bacteria | 5965 |
| 15 | Ga0123354_11005159 | 3300010882 | Bacteria | 536 |
| 16 | Ga0466705_059743 | 3300042612 | Bacteria | 8308 |
| 17 | Ga0562378_2438 | 3300056814 | Bacteria | 15462 |
| 18 | Ga0562374_0270 | 3300057007 | Bacteria | 103042 |
| 19 | Ga0415639_002310 | 3300038395 | Bacteria | 154573 |
| 20 | Ga0466735_204231 | 3300042624 | Bacteria | 1434 |
| 21 | Ga0466702_380024 | 3300042635 | Unclassified | 2008 |
| 22 | Ga0466704_107009 | 3300042643 | Bacteria | 7254 |
| 23 | 2227484190 | 2225789004 | Bacteria | 829 |
| 24 | Ga0466701_054532 | 3300042598 | Unclassified | 2781 |
| 25 | Ga0466707_304242 | 3300042601 | Bacteria | 14355 |
| 26 | Ga0466707_403940 | 3300042601 | Bacteria | 1071 |
| 27 | Ga0466714_005312 | 3300042603 | Bacteria | 30939 |
| 28 | Ga0466714_084117 | 3300042603 | Bacteria | 18481 |
| 29 | Ga0466714_093198 | 3300042603 | Bacteria | 1512 |
| 30 | Ga0466714_143567 | 3300042603 | Bacteria | 4870 |
| 31 | Ga0466716_003820 | 3300042605 | Bacteria | 11944 |
| 32 | Ga0466705_519658 | 3300042612 | Bacteria | 15800 |
| 33 | Ga0466723_078924 | 3300042618 | Bacteria | 4346 |
| 34 | Ga0123357_10227153 | 3300009784 | Bacteria | 2055 |
| 35 | Ga0123355_10017450 | 3300009826 | Bacteria | 11345 |
| 36 | Ga0123355_10024983 | 3300009826 | Bacteria | 9615 |
| 37 | Ga0123355_10035834 | 3300009826 | Bacteria | 8066 |
| 38 | Ga0123353_10168037 | 3300010167 | Bacteria | 3484 |
| 39 | Ga0123353_10197561 | 3300010167 | Unclassified | 3169 |
| 40 | Ga0123353_10337434 | 3300010167 | Bacteria | 2278 |
| 41 | Ga0123353_12297960 | 3300010167 | Bacteria | 649 |
| 42 | Ga0123354_10364930 | 3300010882 | Bacteria | 1268 |
| 43 | Ga0466697_222988 | 3300042611 | Unclassified | 1443 |
| 44 | Ga0415639_001087 | 3300038395 | Bacteria | 37853 |
| 45 | Ga0415639_020900 | 3300038395 | Bacteria | 7266 |
| 46 | Ga0466656_385658 | 3300042550 | Bacteria | 2440 |
| 47 | Ga0466724_50901 | 3300042649 | Bacteria | 4011 |
| 48 | IMNBL1DRAFT_c0034233 | 3300000062 | Bacteria | 1810 |
| 49 | Ga0466706_067390 | 3300042599 | Bacteria | 55994 |
| 50 | Ga0466707_025835 | 3300042601 | Bacteria | 4862 |
| 51 | Ga0466707_243360 | 3300042601 | Bacteria | 29608 |
| 52 | Ga0466716_200399 | 3300042605 | Bacteria | 1150 |
| 53 | Ga0466721_100978 | 3300042608 | Bacteria | 228571 |
| 54 | Ga0466722_245758 | 3300042609 | Bacteria | 8085 |
| 55 | Ga0466698_337884 | 3300042610 | Bacteria | 12427 |
| 56 | Ga0466715_614543 | 3300042616 | Bacteria | 2973 |
| 57 | Ga0123357_10106134 | 3300009784 | Bacteria | 3602 |
| 58 | Ga0123357_10645414 | 3300009784 | Unclassified | 787 |
| 59 | Ga0123356_10000099 | 3300010049 | Bacteria | 91944 |
| 60 | Ga0123356_10050074 | 3300010049 | Bacteria | 3888 |
| 61 | Ga0123356_13184533 | 3300010049 | Unclassified | 571 |
| 62 | Ga0123356_14079521 | 3300010049 | Bacteria | 503 |
| 63 | Ga0123353_10000209 | 3300010167 | Bacteria | 74225 |
| 64 | Ga0123353_10000294 | 3300010167 | Bacteria | 62045 |
| 65 | Ga0123353_10100267 | 3300010167 | Bacteria | 4667 |
| 66 | Ga0123353_12050527 | 3300010167 | Bacteria | 698 |
| 67 | Ga0123354_10001196 | 3300010882 | Bacteria | 30578 |
| 68 | Ga0466697_171318 | 3300042611 | Bacteria | 1007 |
| 69 | Ga0466733_040462 | 3300042659 | Bacteria | 7306 |
| 70 | Ga0160443_100648 | 3300012848 | Bacteria | 19815 |
| 71 | Ga0415639_003419 | 3300038395 | Bacteria | 52955 |
| 72 | Ga0415639_009239 | 3300038395 | Bacteria | 5818 |
| 73 | Ga0466696_453020 | 3300042596 | Bacteria | 2431 |
| 74 | Ga0466730_095014 | 3300042625 | Bacteria | 15821 |
| 75 | Ga0466703_132134 | 3300042636 | Bacteria | 9668 |
| 76 | Ga0466704_496077 | 3300042643 | Bacteria | 3589 |
| 77 | Ga0466724_02361 | 3300042649 | Bacteria | 34785 |
| 78 | 2227191891 | 2225789004 | Bacteria | 35154 |
| 79 | 2227543243 | 2225789004 | Unclassified | 2959 |
| 80 | IMNBL1DRAFT_c0005977 | 3300000062 | Bacteria | 6797 |
| 81 | Ga0104050_1203074 | 3300007153 | Bacteria | 1522 |
| 82 | Ga0466706_118115 | 3300042599 | Unclassified | 1489 |
| 83 | Ga0466706_150029 | 3300042599 | Bacteria | 12161 |
| 84 | Ga0466722_160152 | 3300042609 | Bacteria | 5369 |
| 85 | Ga0466722_259050 | 3300042609 | Bacteria | 3480 |
| 86 | Ga0466723_143854 | 3300042618 | Bacteria | 39856 |
| 87 | Ga0466726_447329 | 3300042619 | Bacteria | 1744 |
| 88 | Ga0466729_179085 | 3300042621 | Bacteria | 60360 |
| 89 | Ga0123355_10000064 | 3300009826 | Bacteria | 113151 |
| 90 | Ga0123356_10072719 | 3300010049 | Bacteria | 3231 |
| 91 | Ga0123356_10110822 | 3300010049 | Bacteria | 2651 |
| 92 | Ga0123356_11060515 | 3300010049 | Unclassified | 979 |
| 93 | Ga0123356_12974213 | 3300010049 | Bacteria | 592 |
| 94 | Ga0123353_10002541 | 3300010167 | Bacteria | 22666 |
| 95 | Ga0123353_10016767 | 3300010167 | Bacteria | 10724 |
| 96 | Ga0123353_10085480 | 3300010167 | Bacteria | 5080 |
| 97 | Ga0123353_10357467 | 3300010167 | Bacteria | 2197 |
| 98 | Ga0530661_000008 | 3300056564 | Bacteria | 327436 |
| 99 | Ga0466690_293810 | 3300042590 | Bacteria | 1752 |
| 100 | Ga0466696_237808 | 3300042596 | Bacteria | 1064 |
| 101 | Ga0466735_186546 | 3300042624 | Bacteria | 2719 |
| 102 | Ga0466702_169237 | 3300042635 | Unclassified | 1706 |
| 103 | Ga0466703_242629 | 3300042636 | Bacteria | 92300 |
| 104 | Ga0466708_048200 | 3300042652 | Bacteria | 3574 |
| 105 | IMNBL1DRAFT_c0018360 | 3300000062 | Bacteria | 2912 |
| 106 | IMNBL1DRAFT_c0117907 | 3300000062 | Bacteria | 700 |
| 107 | Ga0466701_101169 | 3300042598 | Bacteria | 66668 |
| 108 | Ga0466706_169444 | 3300042599 | Bacteria | 3934 |
| 109 | Ga0466707_155375 | 3300042601 | Bacteria | 2218 |
| 110 | Ga0466707_262676 | 3300042601 | Bacteria | 90434 |
| 111 | Ga0466707_306897 | 3300042601 | Unclassified | 1816 |
| 112 | Ga0466714_099042 | 3300042603 | Bacteria | 1097 |
| 113 | Ga0466714_167522 | 3300042603 | Bacteria | 11730 |
| 114 | Ga0466716_117418 | 3300042605 | Bacteria | 2958 |
| 115 | Ga0466722_035400 | 3300042609 | Bacteria | 82053 |
| 116 | Ga0466715_043804 | 3300042616 | Bacteria | 8517 |
| 117 | Ga0466715_162043 | 3300042616 | Bacteria | 36555 |
| 118 | Ga0466726_123696 | 3300042619 | Bacteria | 24670 |
| 119 | Ga0466726_191343 | 3300042619 | Bacteria | 2509 |
| 120 | Ga0123356_10006808 | 3300010049 | Unclassified | 11499 |
| 121 | Ga0123356_10066293 | 3300010049 | Bacteria | 3379 |
| 122 | Ga0123356_10430041 | 3300010049 | Bacteria | 1464 |
| 123 | Ga0123353_10014428 | 3300010167 | Bacteria | 11391 |
| 124 | Ga0123353_10394926 | 3300010167 | Unclassified | 2061 |
| 125 | Ga0123353_10723384 | 3300010167 | Unclassified | 1392 |
| 126 | Ga0123353_10787725 | 3300010167 | Bacteria | 1315 |
| 127 | Ga0123353_10845709 | 3300010167 | Bacteria | 1255 |
| 128 | Ga0123353_12431805 | 3300010167 | Bacteria | 625 |
| 129 | Ga0123354_10282940 | 3300010882 | Bacteria | 1606 |
| 130 | Ga0160471_101894 | 3300012812 | Bacteria | 3760 |
| 131 | Ga0466705_005202 | 3300042612 | Bacteria | 3478 |
| 132 | Ga0415639_007672 | 3300038395 | Bacteria | 13622 |
| 133 | Ga0415639_034433 | 3300038395 | Bacteria | 11352 |
| 134 | Ga0466731_286467 | 3300042622 | Bacteria | 3189 |
| 135 | Ga0466735_187423 | 3300042624 | Bacteria | 1039 |
| 136 | Ga0466702_199259 | 3300042635 | Bacteria | 2911 |
| 137 | Ga0466703_356885 | 3300042636 | Bacteria | 58749 |
| 138 | Ga0466704_387670 | 3300042643 | Bacteria | 16309 |
| 139 | 2227080773 | 2225789004 | Bacteria | 205580 |
| 140 | IMNBL1DRAFT_c0000388 | 3300000062 | Bacteria | 37738 |
| 141 | Ga0466706_063112 | 3300042599 | Bacteria | 4803 |
| 142 | Ga0466714_014154 | 3300042603 | Bacteria | 4661 |
| 143 | Ga0466714_086369 | 3300042603 | Bacteria | 40105 |
| 144 | Ga0466721_272102 | 3300042608 | Bacteria | 1313 |
| 145 | Ga0466722_225422 | 3300042609 | Bacteria | 2782 |
| 146 | Ga0466711_274923 | 3300042615 | Bacteria | 5249 |
| 147 | Ga0466723_322684 | 3300042618 | Bacteria | 3300 |
| 148 | Ga0466728_204296 | 3300042620 | Bacteria | 1284 |
| 149 | Ga0466728_208642 | 3300042620 | Bacteria | 62806 |
| 150 | Ga0123355_10002085 | 3300009826 | Bacteria | 28219 |
| 151 | Ga0123355_10025603 | 3300009826 | Bacteria | 9501 |
| 152 | Ga0123355_10026081 | 3300009826 | Bacteria | 9422 |
| 153 | Ga0123355_10243078 | 3300009826 | Bacteria | 2547 |
| 154 | Ga0123355_10251348 | 3300009826 | Unclassified | 2488 |
| 155 | Ga0123356_10319353 | 3300010049 | Bacteria | 1665 |
| 156 | Ga0123353_10003404 | 3300010167 | Bacteria | 20101 |
| 157 | Ga0123353_10031925 | 3300010167 | Bacteria | 8170 |
| 158 | Ga0123353_10106999 | 3300010167 | Bacteria | 4506 |
| 159 | Ga0123353_10144602 | 3300010167 | Bacteria | 3804 |
| 160 | Ga0123353_11003280 | 3300010167 | Bacteria | 1121 |
| 161 | Ga0123353_11363453 | 3300010167 | Bacteria | 915 |
| 162 | Ga0123353_13352356 | 3300010167 | Unclassified | 510 |
| 163 | Ga0466733_212667 | 3300042659 | Bacteria | 4307 |
| 164 | Ga0415639_016365 | 3300038395 | Unclassified | 3200 |
| 165 | Ga0466690_281416 | 3300042590 | Bacteria | 9929 |
| 166 | Ga0466690_388865 | 3300042590 | Bacteria | 6149 |
| 167 | Ga0466691_213249 | 3300042593 | Bacteria | 4189 |
| 168 | Ga0466702_238106 | 3300042635 | Bacteria | 2017 |
| 169 | Ga0466704_322227 | 3300042643 | Bacteria | 202158 |
| 170 | 2227074025 | 2225789003 | Unclassified | 514 |
| 171 | 2227581681 | 2225789004 | Bacteria | 518 |
| 172 | IMNBL1DRAFT_c0000426 | 3300000062 | Bacteria | 35421 |
| 173 | Ga0466707_089699 | 3300042601 | Bacteria | 1501 |
| 174 | Ga0466713_069636 | 3300042602 | Bacteria | 98037 |
| 175 | Ga0466714_017536 | 3300042603 | Bacteria | 6524 |
| 176 | Ga0466705_423871 | 3300042612 | Bacteria | 10344 |
| 177 | Ga0466726_244051 | 3300042619 | Bacteria | 1559 |
| 178 | Ga0123357_10873610 | 3300009784 | Bacteria | 588 |
| 179 | Ga0123355_10001203 | 3300009826 | Bacteria | 36038 |
| 180 | Ga0123355_10060210 | 3300009826 | Bacteria | 6132 |
| 181 | Ga0123355_10088678 | 3300009826 | Bacteria | 4912 |
| 182 | Ga0123355_10284472 | 3300009826 | Bacteria | 2278 |
| 183 | Ga0123356_10025301 | 3300010049 | Bacteria | 5581 |
| 184 | Ga0123356_10096295 | 3300010049 | Bacteria | 2830 |
| 185 | Ga0123356_10134944 | 3300010049 | Bacteria | 2424 |
| 186 | Ga0123356_10474121 | 3300010049 | Unclassified | 1403 |
| 187 | Ga0123356_10569386 | 3300010049 | Bacteria | 1295 |
| 188 | Ga0123356_10950748 | 3300010049 | Bacteria | 1030 |
| 189 | Ga0123356_11288004 | 3300010049 | Unclassified | 894 |
| 190 | Ga0123353_10042748 | 3300010167 | Bacteria | 7172 |
| 191 | Ga0123353_11315697 | 3300010167 | Bacteria | 937 |
| 192 | Ga0123353_11549637 | 3300010167 | Bacteria | 840 |
| 193 | Ga0123353_12661256 | 3300010167 | Bacteria | 590 |
| 194 | Ga0123354_10432815 | 3300010882 | Bacteria | 1082 |
| 195 | Ga0466733_144595 | 3300042659 | Bacteria | 1206 |
| 196 | Ga0562374_0004 | 3300057007 | Bacteria | 3025848 |
| 197 | Ga0466696_296201 | 3300042596 | Bacteria | 26567 |
| 198 | Ga0466703_151978 | 3300042636 | Bacteria | 1477 |
| 199 | Ga0466703_182394 | 3300042636 | Bacteria | 2837 |
| 200 | AglaG_contig14194 | 2084038013 | Bacteria | 785 |
| 201 | 2226985391 | 2225789003 | Bacteria | 1766 |
| 202 | 2227417774 | 2225789004 | Bacteria | 1051 |
| 203 | IMNBL1DRAFT_c0001208 | 3300000062 | Bacteria | 19538 |
| 204 | AustNasuHG_c1006264 | 3300000089 | Bacteria | 4251 |
| 205 | Ga0466706_212835 | 3300042599 | Bacteria | 5739 |
| 206 | Ga0466707_282184 | 3300042601 | Bacteria | 7703 |
| 207 | Ga0466713_030346 | 3300042602 | Bacteria | 25277 |
| 208 | Ga0466714_053071 | 3300042603 | Bacteria | 1248 |
| 209 | Ga0466717_175607 | 3300042604 | Unclassified | 1200 |
| 210 | Ga0466719_161140 | 3300042606 | Bacteria | 1788 |
| 211 | Ga0466719_201247 | 3300042606 | Bacteria | 254275 |
| 212 | Ga0466721_343500 | 3300042608 | Unclassified | 1427 |
| 213 | Ga0466715_584084 | 3300042616 | Bacteria | 48896 |
| 214 | Ga0466726_065605 | 3300042619 | Bacteria | 46464 |
| 215 | Ga0466726_164962 | 3300042619 | Bacteria | 4514 |
| 216 | Ga0123357_10091036 | 3300009784 | Bacteria | 3975 |
| 217 | Ga0123357_10611539 | 3300009784 | Bacteria | 830 |
| 218 | Ga0123355_10077893 | 3300009826 | Bacteria | 5298 |
| 219 | Ga0123356_10005392 | 3300010049 | Bacteria | 13028 |
| 220 | Ga0123353_10066163 | 3300010167 | Bacteria | 5801 |
| 221 | Ga0123353_10072974 | 3300010167 | Bacteria | 5516 |
| 222 | Ga0123353_11676139 | 3300010167 | Bacteria | 798 |
| 223 | Ga0123353_13424095 | 3300010167 | Bacteria | 503 |
| 224 | Ga0160454_100150 | 3300012798 | Bacteria | 83122 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00444 | Ribosomal_L36 | Ribosomal protein L36 | 10 | 46 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.