Protein Family IF08979

Metagenome Isolate
231 Members
188 Samples
99 Scaffolds
341.24 Avg Length

🧬 Representative Sequence

ID
3300042625|Ga0466730_061587|Ga0466730_061587_749_1897
Length
382 aa
Sequence
VVSVTIGPSIYLTWSVKETVFILIMECVKWGKPVLTRIRVMKKIGFLSFGHWTPSSQSATRSAADTLLQSIDLAVAAEELGADGAYFRVHHFARQLSSPFPLLAAIGAKTKRIEIGTGVIDMRYENPMYMAEEASAADLISGGRLQLGISRGSPEQVIDGWRYFGYVPQEGENESDMARRHTEVLLEALRGEGFAKPNPQPMFPNPPGLLRLEPHSEGLRDRIWWGAGSNATAVWAAQLGMNLQSSTLKDDETGEPFHIQQAKQIRAYREAWAQAGHTRTPRVSVSRSIFALMNDRDRSYFGASRNDSDSVGFLDEKTRAIFGRSYAAEPDKLIDQLKQDEAIAEADTLLLTVPNQLGVDYNAHVIESILKHVAPALGWRDS

📊 Sample Types

Isolate 57.1%
Metagenome 42.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 15.3%
Culicidae 8.5%
Termitidae 8.5%
Anthocoridae 7.9%
Muscidae 7.9%
Coreidae 7.9%
Drosophilidae 7.9%
Curculionidae 6.2%
Armadillidiidae 4.0%
Tenebrionidae 4.0%
Elmidae 2.8%
Scarabaeidae 2.3%
Cambaridae 1.7%
Apidae 1.7%
Calliphoridae 1.7%
Cerambycidae 1.7%
Sarcophagidae 1.1%
Formicidae 1.1%
Aphididae 1.1%
Largidae 1.1%
Hydrophilidae 0.6%
Daphniidae 0.6%
Thomisidae 0.6%
Thripidae 0.6%
Anthomyiidae 0.6%
Cimicidae 0.6%
Crambidae 0.6%
Plutellidae 0.6%
Tephritidae 0.6%
Reduviidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 204
Eukaryota 0
Viruses 0
Unclassified 27

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
2 2873558832 Propioniciclava coleopterorum HDW11 Isolate Hydrophilidae
3 2874434233 Serratia marcescens ADJS-2C_Red Isolate Unclassified
4 2961232173 Serratia sp. OLLOLW30 Isolate Anthocoridae
5 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
6 2504756063 Isoptericola variabilis J5 Isolate Unclassified
7 2556921669 Shinella sp. DD12 Isolate Daphniidae
8 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
9 2718217944 Serratia marcescens AS1 Isolate Culicidae
10 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
11 2970791725 Serratia sp. OLBL1 Isolate Anthocoridae
12 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
13 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
14 2996467878 Serratia sp. OLFL2 Isolate Anthocoridae
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
18 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
19 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
22 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
23 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
24 8100176769 Kosakonia sp. S57 Isolate Curculionidae
25 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
26 8109397740 Rhodococcus triatomae DSM 44892 Isolate Unclassified
27 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
28 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
29 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
30 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
31 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
32 2922113941 Serratia sp. OLEL1 Isolate Anthocoridae
33 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
34 2937751072 Serratia sp. OLMTLW26 Isolate Anthocoridae
35 2958255616 Serratia marcescens TM Isolate
36 2965197371 Serratia sp. OLCL1 Isolate Anthocoridae
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
40 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
41 2505679068 Isoptericola variabilis 225 Isolate Unclassified
42 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
43 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
44 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
45 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
46 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
47 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
48 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
49 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
50 8062637095 Yimella sp. cx-51 Isolate Cambaridae
51 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
52 8102117041 Caballeronia sp. INML3 Isolate Coreidae
53 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
54 8102982778 Erwinia sp. S63 Isolate Curculionidae
55 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
56 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
57 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
58 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
59 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
60 2878947168 Serratia marcescens ADJS-2D_White Isolate Unclassified
61 2937735258 Serratia marcescens KZ11 Isolate Apidae
62 2961247850 Serratia sp. OLAL2 Isolate Anthocoridae
63 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
64 2619619079 Sphingomonas sp. Mn802worker Isolate Termitidae
65 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
66 2977727922 Cronobacter sakazakii MOD1-Md33s Isolate Muscidae
67 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
68 3300007224 Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut Metagenome Unclassified
69 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
70 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
71 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
72 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
73 8004307473 Serratia sp. OLIL2 Isolate Anthocoridae
74 8004571736 Serratia sp. OLDL1 Isolate Anthocoridae
75 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
76 8062747827 Yimella sp. cx-51 Isolate Cambaridae
77 8100181737 Kosakonia sp. S58 Isolate Curculionidae
78 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
79 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
80 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
81 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
82 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
83 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
84 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
85 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
86 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
87 8065462725 Tatumella sp. JGM100 Isolate Drosophilidae
88 8065466226 Tatumella sp. JGM130 Isolate Drosophilidae
89 8065469765 Tatumella sp. JGM16 Isolate Drosophilidae
90 8100171289 Kosakonia sp. S42 Isolate Curculionidae
91 8102124461 Caballeronia sp. INML3B Isolate Coreidae
92 8103002986 Erwinia sp. S38 Isolate Curculionidae
93 8103008710 Erwinia sp. S43 Isolate Curculionidae
94 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
95 2871771314 Pantoea sp. Ae16 Isolate Culicidae
96 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
97 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
98 2854540230 Acetobacter sp. DsW_063 Isolate Drosophilidae
99 2645727860 Winslowiella iniecta B120 Isolate Aphididae
100 2703719240 Serratia marcescens ano2 Isolate Unclassified
101 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
102 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
103 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
104 3004010258 Citrobacter sp. JGM124 Isolate Drosophilidae
105 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
106 2820146621 Unclassified Proteobacteria Emb289P3bin103 Isolate Unclassified
107 648276708 Pantoea sp. aB Isolate Unclassified
108 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
109 8073544309 Actinomadura sp. RB99 Isolate Termitidae
110 8074292191 Tatumella sp. JGM94 Isolate Drosophilidae
111 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
112 8102102351 Caballeronia sp. INML1 Isolate Coreidae
113 2847708326 Serratia liquefaciens P2ACOL2 Isolate Cerambycidae
114 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
115 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
116 2874504452 Serratia marcescens ADJS-2C_Purple Isolate Unclassified
117 2909412500 Yimella sp. cx-573 Isolate Cambaridae
118 2931425734 Nocardioides sp. J2M5 Isolate
119 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
120 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
121 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
122 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
123 2996406003 Serratia sp. OLJL1 Isolate Anthocoridae
124 3001462594 Tatumella sp. JGM91 Isolate Drosophilidae
125 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
126 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
127 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
128 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
129 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
130 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
131 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
132 8074288691 Tatumella sp. JGM82 Isolate Drosophilidae
133 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
134 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
135 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
136 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
137 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
138 2908241010 Streptomyces sp. HF10 Isolate Termitidae
139 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
140 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
141 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
142 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
143 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
144 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
145 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
146 2619619082 Pantoea agglomerans SL1_M5 Isolate Unclassified
147 2978161719 Serratia marcescens KZ2 Isolate Apidae
148 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
149 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
150 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
151 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
152 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
153 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
154 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
155 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
156 8018312681 Enterobacter sp. OLF Isolate Tephritidae
157 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
158 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
159 8099192374 Erwinia typographi IC4 Isolate Curculionidae
160 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
161 8102109360 Caballeronia sp. INML2 Isolate Coreidae
162 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
163 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
164 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
165 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
166 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
167 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
168 2961206375 Serratia sp. OMLW3 Isolate Anthocoridae
169 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
170 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
171 2648501209 Winslowiella iniecta B149 Isolate Aphididae
172 2703719239 Serratia marcescens ano1 Isolate Unclassified
173 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
174 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
175 3300005318 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut Metagenome Drosophilidae
176 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
177 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
178 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
179 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
180 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
181 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
182 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
183 8004285568 Serratia sp. OLHL2 Isolate Anthocoridae
184 8004541719 Serratia marcescens KZ19 Isolate Apidae
185 8004582426 Serratia sp. OSPLW9 Isolate Anthocoridae
186 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
187 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
188 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160440_100657 3300012815 Bacteria 7994
2 Ga0160432_100229 3300012818 Bacteria 47865
3 Ga0160455_104790 3300012837 Unclassified 1580
4 Ga0160472_101056 3300012839 Unclassified 9619
5 Ga0160433_100127 3300012846 Bacteria 68773
6 Ga0160457_1005859 3300012858 Bacteria 1846
7 Ga0160457_1006584 3300012858 Bacteria 1724
8 Ga0466724_47439 3300042649 Bacteria 410820
9 Ga0466701_103424 3300042598 Unclassified 117519
10 Ga0123355_10020226 3300009826 Unclassified 10623
11 Ga0123356_10004020 3300010049 Bacteria 15266
12 Ga0104045_1002470 3300007085 Bacteria 2318
13 Ga0160468_100172 3300012819 Bacteria 48018
14 Ga0160455_100028 3300012837 Bacteria 333132
15 Ga0160460_100023 3300012845 Bacteria 338828
16 Ga0160445_100643 3300012847 Unclassified 14598
17 Ga0160443_100006 3300012848 Bacteria 647325
18 Ga0160434_100161 3300012850 Bacteria 34797
19 Ga0265387_1000026 3300024582 Bacteria 60790
20 Ga0466734_096875 3300042623 Bacteria 1577
21 Ga0466725_019120 3300042654 Bacteria 2293
22 Ga0466713_120225 3300042602 Bacteria 135023
23 Ga0160471_100020 3300012812 Bacteria 340969
24 Meta3P_1008852 3300002464 Unclassified 3646
25 Ga0562378_3801 3300056814 Bacteria 7819
26 Ga0160459_100628 3300012831 Unclassified 12670
27 Ga0160446_100169 3300012835 Bacteria 50416
28 Ga0160436_1000138 3300012861 Bacteria 37086
29 Ga0316159_10278 3300030930 Bacteria 8439
30 Ga0466730_041094 3300042625 Unclassified 9355
31 Ga0466724_21836 3300042649 Bacteria 1615
32 Ga0466724_48624 3300042649 Unclassified 6284
33 Ga0123356_10032651 3300010049 Bacteria 4870
34 Ga0123353_10001155 3300010167 Bacteria 32219
35 CVPL010L_1000006 3300002932 Bacteria 148663
36 Ga0063521_1000457 3300003973 Bacteria 20381
37 Ga0104051_1102961 3300007078 Unclassified 1696
38 Ga0466710_302047 3300042613 Bacteria 3606
39 Ga0160447_103027 3300012849 Bacteria 5572
40 Ga0160430_104927 3300012852 Bacteria 3181
41 Ga0160457_1001637 3300012858 Unclassified 5830
42 Ga0466730_073669 3300042625 Bacteria 406091
43 Ga0466730_091986 3300042625 Bacteria 1636
44 Ga0466724_06048 3300042649 Unclassified 26129
45 Ga0466724_14457 3300042649 Unclassified 137665
46 Ga0466724_45081 3300042649 Bacteria 99888
47 Ga0123355_10009012 3300009826 Unclassified 15124
48 Ga0123356_10074150 3300010049 Bacteria 3201
49 Ga0160465_100002 3300012803 Bacteria 834901
50 DPOL_contig00234 2035918003 Bacteria 11698
51 FGTW_contig25759 2065487013 Unclassified 8189
52 CVPL010L_1002744 3300002932 Unclassified 3041
53 Ga0104049_1025004 3300007103 Bacteria 3335
54 Ga0105005_1024968 3300007505 Unclassified 11864
55 Ga0530661_000201 3300056564 Bacteria 50515
56 Ga0562375_0559 3300056856 Bacteria 73847
57 Ga0160441_100119 3300012825 Bacteria 90566
58 Ga0160472_100081 3300012839 Bacteria 156805
59 Ga0160443_100184 3300012848 Bacteria 84526
60 Ga0247289_0041 3300035363 Bacteria 40105
61 Ga0466657_127725 3300042582 Bacteria 62629
62 Ga0123355_10036228 3300009826 Bacteria 8022
63 Ga0160442_100095 3300012806 Bacteria 101997
64 Ga0160471_100257 3300012812 Bacteria 17526
65 Ga0074188_1000288 3300005318 Bacteria 35346
66 Ga0562378_0014 3300056814 Bacteria 962225
67 Ga0160470_101895 3300012813 Unclassified 4445
68 Ga0160452_100025 3300012834 Bacteria 245284
69 Ga0160435_1000470 3300012857 Unclassified 13485
70 Ga0247289_0187 3300035363 Unclassified 14097
71 Ga0415639_073305 3300038395 Bacteria 2693
72 Ga0466707_422806 3300042601 Bacteria 1598
73 Ga0123355_10020087 3300009826 Bacteria 10654
74 Ga0123355_10106937 3300009826 Unclassified 4384
75 FGTW_contig31427 2065487013 Bacteria 4532
76 Ga0063521_1000032 3300003973 Bacteria 118735
77 Ga0063521_1001353 3300003973 Unclassified 6910
78 Ga0160467_100823 3300012829 Bacteria 20487
79 Ga0160459_103631 3300012831 Bacteria 2196
80 Ga0160446_100103 3300012835 Bacteria 77158
81 Ga0160472_100052 3300012839 Bacteria 192881
82 Ga0160433_100310 3300012846 Bacteria 31416
83 Ga0160434_110108 3300012850 Bacteria 1533
84 Ga0466730_075830 3300042625 Unclassified 50863
85 Ga0123355_10035632 3300009826 Unclassified 8087
86 Ga0123356_10000321 3300010049 Bacteria 55175
87 FGTW_contig21348 2065487013 Bacteria 1581
88 Ga0466697_200239 3300042611 Bacteria 2099
89 Ga0562375_1015 3300056856 Bacteria 44532
90 Ga0562376_1567 3300056857 Unclassified 31408
91 Ga0160460_104572 3300012845 Bacteria 2099
92 Ga0316159_10343 3300030930 Bacteria 9155
93 Ga0466730_061587 3300042625 Bacteria 10763
94 Ga0123355_10522123 3300009826 Bacteria 1452
95 Ga0123356_10005071 3300010049 Bacteria 13501
96 Ga0123353_10043284 3300010167 Unclassified 7132
97 DPOL_contig14439 2035918003 Bacteria 12480
98 Ga0104041_1001647 3300007106 Unclassified 11734
99 Ga0104147_1012250 3300007224 Bacteria 9168

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00296 Bac_luciferase Luciferase-like monooxygenase 48 291 0.86

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00296 GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.