Protein Family IF08898
Metagenome
Isolate
298
Members
231
Samples
123
Scaffolds
465.06
Avg Length
Representative Sequence
- ID
- 3300042625|Ga0466730_017544|Ga0466730_017544_4847_6694
- Length
- 569 aa
- Sequence
- MALALSGADGAAARAPSPASFFRIAVSFLPGRAARRAARPITRSRQDRTAQPASQYLSLSVQSLRRNIASQCNKNAAQKCIDQVQHALQPIPEAPTAIDAGDSMSFVIVLAALAFLMLAAYRGYSVILFAPVAALGAVLLTDPSAVAPVFSGIFMEKMVGFVKLYFPVFLLGAVFGKVIELSGYSEAIVHAAIRYIGRSRANAVIVAVCALLTYGGVSLFVVVFAVYPFAAELYRQSDIPKRLMPGAIALGAFSFTMDSLPGTPQIQNIIPTTFFKTTAWAAPALGVIGSLFIIVVGLAYLEWRRRSALAKGEGYGTSLVNEPEHVKTDHLPNPLLAITPLVLVGVANFFLTRWIPQWYGDTYTITADMLPGIHAPVTTTVKQLVGIWSVEGALLLGIAFVIVTAFPRVKERFASGTKAAVAGALLASLNTASEYGFGGVIAALPGFLVVSDALKSIPNPLVNAAVSVSSLAGITGSASGGMSIALAAMSDVFIKGAQAANIPLDVLHRVVAMASGGMDTLPHNGAVITLLAVTGLTHRESYRDIFAVTVIKTMAVFFVIAVYYATGLV
Sample Types
Isolate
58.7%
Metagenome
41.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
35.9%
Unclassified
8.5%
Formicidae
8.5%
Termitidae
6.3%
Culicidae
5.8%
Anthocoridae
5.8%
Elmidae
4.5%
Curculionidae
3.6%
Pyralidae
2.2%
Scarabaeidae
1.8%
Tenebrionidae
1.8%
Armadillidiidae
1.8%
Tephritidae
1.3%
Apidae
1.3%
Berytidae
0.9%
Bombycidae
0.9%
Alydidae
0.9%
Largidae
0.9%
Kalotermitidae
0.9%
Hydrophilidae
0.9%
Passalidae
0.4%
Plutellidae
0.4%
Cixiidae
0.4%
Drosophilidae
0.4%
Noctuidae
0.4%
Pentatomidae
0.4%
Carabidae
0.4%
Eresidae
0.4%
Ocypodidae
0.4%
Trigoniulidae
0.4%
Calliphoridae
0.4%
Portunidae
0.4%
Taxonomy
Archaea
0
Bacteria
260
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 2 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 3 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 4 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 5 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 6 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 7 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 8 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 9 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 10 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 11 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 12 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 13 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 14 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 15 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 16 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 17 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 24 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 25 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 26 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 27 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 28 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 29 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 30 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 31 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 32 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 33 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 34 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 35 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 36 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 37 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 38 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 39 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 40 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 41 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 42 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 43 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 44 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 45 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 46 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 47 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 48 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 49 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 50 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 51 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 52 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 53 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 54 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 55 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 56 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 57 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 58 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 59 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 60 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 61 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 62 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 63 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 64 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 65 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 66 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 67 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 68 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 69 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 70 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 71 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 72 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 73 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 74 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 75 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 76 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 77 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 78 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 79 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 80 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 81 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 82 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 83 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 84 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 85 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 86 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 87 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 88 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 89 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 90 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 91 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 92 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 93 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 94 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 95 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 96 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 97 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 98 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 99 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 100 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 101 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 102 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 103 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 104 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 105 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 106 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 107 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 108 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 109 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 110 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 111 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 112 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 113 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 114 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 115 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 116 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 117 | 2958255616 | Serratia marcescens TM | Isolate | |
| 118 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 119 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 120 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 121 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 122 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 123 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 124 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 125 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 126 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 127 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 128 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 129 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 130 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 131 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 132 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 133 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 134 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 135 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 136 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 137 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 138 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 139 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 140 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 141 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 142 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 143 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 144 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 145 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 146 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 147 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 148 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 149 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 150 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 151 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 152 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 153 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 154 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 155 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 156 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 157 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 158 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 159 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 160 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 161 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 162 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 163 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 164 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 165 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 166 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 167 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 168 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 169 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 170 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 171 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 172 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 173 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 174 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 175 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 176 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 177 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 178 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 179 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 180 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 181 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 182 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 183 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 184 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 185 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 186 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 187 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 188 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 189 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 190 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 191 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 192 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 193 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 194 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 195 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 196 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 197 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 198 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 199 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 200 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 201 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 202 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 203 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 204 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 205 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 206 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 207 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 208 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 209 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 210 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 211 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 212 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 213 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 214 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 215 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 216 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 217 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 218 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 219 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 220 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 221 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 222 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 223 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 224 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 225 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 226 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 227 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 228 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 229 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 230 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 231 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160447_100644 | 3300012849 | Unclassified | 15518 |
| 2 | Ga0160447_101478 | 3300012849 | Unclassified | 9120 |
| 3 | Ga0160448_100095 | 3300012854 | Bacteria | 46602 |
| 4 | Ga0247290_00115 | 3300035364 | Bacteria | 24813 |
| 5 | Ga0466701_012928 | 3300042598 | Bacteria | 113791 |
| 6 | Ga0466701_022881 | 3300042598 | Bacteria | 168971 |
| 7 | SPBB_contig11435 | 2044078006 | Unclassified | 4825 |
| 8 | CVPL005W_1000835 | 3300002934 | Unclassified | 10201 |
| 9 | Ga0103265_1004845 | 3300007068 | Bacteria | 1891 |
| 10 | Ga0103260_1000539 | 3300007139 | Bacteria | 7253 |
| 11 | Ga0102737_1000832 | 3300007142 | Bacteria | 9525 |
| 12 | Ga0103264_1002357 | 3300007188 | Bacteria | 10128 |
| 13 | Ga0160470_102098 | 3300012813 | Bacteria | 4032 |
| 14 | Ga0160433_100202 | 3300012846 | Unclassified | 47788 |
| 15 | Ga0160434_100010 | 3300012850 | Unclassified | 289054 |
| 16 | Ga0160435_1008841 | 3300012857 | Unclassified | 2158 |
| 17 | Ga0466730_019920 | 3300042625 | Bacteria | 22513 |
| 18 | Ga0466730_103009 | 3300042625 | Unclassified | 15086 |
| 19 | Ga0466709_233271 | 3300042648 | Bacteria | 25413 |
| 20 | Ga0160464_100343 | 3300012805 | Bacteria | 39328 |
| 21 | Ga0160471_103223 | 3300012812 | Unclassified | 2487 |
| 22 | FGTW_contig30445 | 2065487013 | Unclassified | 26971 |
| 23 | 2211957129 | 2209111004 | Bacteria | 7306 |
| 24 | Ga0102736_1000142 | 3300007052 | Bacteria | 17331 |
| 25 | Ga0102736_1000355 | 3300007052 | Bacteria | 9686 |
| 26 | Ga0102740_1002470 | 3300007140 | Bacteria | 5007 |
| 27 | Ga0160460_100218 | 3300012845 | Bacteria | 55046 |
| 28 | Ga0160460_101098 | 3300012845 | Bacteria | 10675 |
| 29 | Ga0160443_100240 | 3300012848 | Unclassified | 58855 |
| 30 | Ga0160447_100387 | 3300012849 | Bacteria | 22025 |
| 31 | Ga0160447_101191 | 3300012849 | Unclassified | 10405 |
| 32 | Ga0160430_100031 | 3300012852 | Bacteria | 185712 |
| 33 | Ga0160457_1000076 | 3300012858 | Unclassified | 149137 |
| 34 | Ga0160436_1000286 | 3300012861 | Unclassified | 23012 |
| 35 | Ga0466731_254803 | 3300042622 | Bacteria | 2783 |
| 36 | Ga0466730_017544 | 3300042625 | Bacteria | 13338 |
| 37 | Ga0160464_100056 | 3300012805 | Bacteria | 133656 |
| 38 | Ga0466701_039069 | 3300042598 | Bacteria | 73033 |
| 39 | Ga0466707_096100 | 3300042601 | Bacteria | 163276 |
| 40 | DPOL_contig00676 | 2035918003 | Bacteria | 58181 |
| 41 | CVPL010W_10000115 | 3300002931 | Bacteria | 60455 |
| 42 | CVPL010W_10005516 | 3300002931 | Bacteria | 13472 |
| 43 | CVPL010L_1000076 | 3300002932 | Bacteria | 58362 |
| 44 | CVPL005L_10012049 | 3300002938 | Bacteria | 6554 |
| 45 | Ga0103261_1000172 | 3300007083 | Bacteria | 10920 |
| 46 | Ga0102739_1000020 | 3300007095 | Bacteria | 54402 |
| 47 | Ga0102738_1001957 | 3300007141 | Bacteria | 3118 |
| 48 | Ga0103264_1022996 | 3300007188 | Bacteria | 3388 |
| 49 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 50 | Ga0466710_164974 | 3300042613 | Unclassified | 2338 |
| 51 | Ga0160472_100604 | 3300012839 | Bacteria | 20064 |
| 52 | Ga0466731_426743 | 3300042622 | Bacteria | 7277 |
| 53 | Ga0466730_023130 | 3300042625 | Bacteria | 2147 |
| 54 | Ga0466724_58931 | 3300042649 | Unclassified | 9922 |
| 55 | Ga0160442_100112 | 3300012806 | Bacteria | 90656 |
| 56 | Ga0160470_100033 | 3300012813 | Bacteria | 205436 |
| 57 | CVPL010L_1000158 | 3300002932 | Unclassified | 47107 |
| 58 | Ga0103265_1000397 | 3300007068 | Bacteria | 7404 |
| 59 | Ga0103260_1004304 | 3300007139 | Unclassified | 4001 |
| 60 | Ga0530661_002268 | 3300056564 | Bacteria | 7527 |
| 61 | Ga0160456_100091 | 3300012820 | Bacteria | 110976 |
| 62 | Ga0160460_100405 | 3300012845 | Unclassified | 27215 |
| 63 | Ga0160435_1003998 | 3300012857 | Unclassified | 3446 |
| 64 | Ga0466730_022079 | 3300042625 | Unclassified | 13360 |
| 65 | Ga0466724_37332 | 3300042649 | Bacteria | 112894 |
| 66 | Ga0466700_053917 | 3300042600 | Bacteria | 7874 |
| 67 | Ga0466707_386788 | 3300042601 | Bacteria | 2815 |
| 68 | DPO_contig07988 | 2032320009 | Unclassified | 15562 |
| 69 | FGTW_contig30628 | 2065487013 | Bacteria | 13269 |
| 70 | Meta3P_1000068 | 3300002464 | Bacteria | 52535 |
| 71 | Meta3P_1000553 | 3300002464 | Unclassified | 12774 |
| 72 | Meta3P_1003641 | 3300002464 | Unclassified | 7480 |
| 73 | Ga0063521_1000406 | 3300003973 | Bacteria | 23634 |
| 74 | Ga0103261_1000037 | 3300007083 | Bacteria | 63611 |
| 75 | Ga0103261_1002793 | 3300007083 | Unclassified | 2739 |
| 76 | Ga0102734_1001937 | 3300007129 | Bacteria | 5011 |
| 77 | Ga0102740_1002264 | 3300007140 | Bacteria | 4478 |
| 78 | Ga0102737_1002259 | 3300007142 | Unclassified | 4866 |
| 79 | Ga0466697_234423 | 3300042611 | Bacteria | 4181 |
| 80 | Ga0160447_100261 | 3300012849 | Bacteria | 28457 |
| 81 | Ga0160435_1000898 | 3300012857 | Unclassified | 8108 |
| 82 | Ga0160436_1000072 | 3300012861 | Bacteria | 53854 |
| 83 | Ga0466701_003297 | 3300042598 | Bacteria | 5909 |
| 84 | Ga0466724_10303 | 3300042649 | Bacteria | 179727 |
| 85 | Ga0466713_142950 | 3300042602 | Bacteria | 53843 |
| 86 | SPBB_contig11512 | 2044078006 | Bacteria | 130870 |
| 87 | IMNBL1DRAFT_c0000724 | 3300000062 | Bacteria | 26181 |
| 88 | Ga0103266_1005200 | 3300007067 | Bacteria | 1696 |
| 89 | Ga0102735_1001485 | 3300007080 | Unclassified | 6932 |
| 90 | Ga0103261_1000903 | 3300007083 | Bacteria | 11226 |
| 91 | Ga0103260_1000061 | 3300007139 | Bacteria | 31710 |
| 92 | Ga0102740_1006362 | 3300007140 | Unclassified | 2115 |
| 93 | Ga0102737_1002731 | 3300007142 | Unclassified | 4246 |
| 94 | Ga0562378_0110 | 3300056814 | Bacteria | 213613 |
| 95 | Ga0160472_100147 | 3300012839 | Bacteria | 103531 |
| 96 | Ga0466657_034537 | 3300042582 | Bacteria | 9190 |
| 97 | Ga0466657_070885 | 3300042582 | Bacteria | 103407 |
| 98 | Ga0466657_212094 | 3300042582 | Bacteria | 3785 |
| 99 | Ga0123353_10016077 | 3300010167 | Bacteria | 10916 |
| 100 | DPOL_contig05103 | 2035918003 | Bacteria | 13998 |
| 101 | DPOL_contig19300 | 2035918003 | Bacteria | 19012 |
| 102 | FGTW_contig31684 | 2065487013 | Unclassified | 3729 |
| 103 | CVPL010W_10010119 | 3300002931 | Unclassified | 8291 |
| 104 | Ga0103263_100101 | 3300007042 | Bacteria | 19518 |
| 105 | Ga0102734_1001987 | 3300007129 | Bacteria | 4932 |
| 106 | Ga0103268_1000755 | 3300007192 | Unclassified | 9162 |
| 107 | Ga0103268_1001452 | 3300007192 | Bacteria | 5878 |
| 108 | Ga0105005_1091688 | 3300007505 | Bacteria | 3119 |
| 109 | Ga0160456_101622 | 3300012820 | Bacteria | 5097 |
| 110 | Ga0160472_100481 | 3300012839 | Unclassified | 27326 |
| 111 | Ga0160460_101972 | 3300012845 | Bacteria | 5531 |
| 112 | Ga0160448_109200 | 3300012854 | Bacteria | 2190 |
| 113 | Ga0466657_011924 | 3300042582 | Bacteria | 2252 |
| 114 | Ga0466724_35550 | 3300042649 | Bacteria | 3759 |
| 115 | Ga0466701_061815 | 3300042598 | Unclassified | 1932 |
| 116 | Ga0466714_120238 | 3300042603 | Bacteria | 4723 |
| 117 | DPO_contig07987 | 2032320009 | Unclassified | 15481 |
| 118 | CVPL005W_1001467 | 3300002934 | Bacteria | 6194 |
| 119 | CVPL005L_10013159 | 3300002938 | Unclassified | 9071 |
| 120 | Ga0102736_1000065 | 3300007052 | Bacteria | 32032 |
| 121 | Ga0103260_1000894 | 3300007139 | Unclassified | 5553 |
| 122 | Ga0102740_1000007 | 3300007140 | Bacteria | 63052 |
| 123 | Ga0102738_1000099 | 3300007141 | Bacteria | 30464 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.