Protein Family IF08804
Metagenome
Isolate
133
Members
73
Samples
111
Scaffolds
303.54
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_136972|Ga0466735_136972_353_1378
- Length
- 341 aa
- Sequence
- MGQSFLRRKSFLSDPRPAPHSEYSAIDCSVTIAGVRLRNPVIAASGTFGYGEEYAELAGVTQLGGICTKGLTLKPRTGNNGVRLWETPAGLLNSIGLENPGIEHFIENQLPTMKKLGPVVIANLSGSDVEEYAAGAKLLDASSVDMIELNISCPNVKQGGMSFGLQPEAALQVTEAVRKAAPHKSLMVKLSPNAPDLAAVARSCINAGADALSLVNTFKAMAVDIEQRRPVFDNVSAGLSGPAIKPIALRMVWELWEALRVGEGAGNTDPLSQNTRIPIVGMGGIASAIDAIEFLSAGAQAIQIGSATFAHPHTMIEIIGGIAAYMERKGLRTLDEICIRT
Sample Types
Isolate
16.5%
Metagenome
83.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.1%
Kalotermitidae
18.1%
Unclassified
11.1%
Blattidae
9.7%
Apidae
8.3%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Hodotermitidae
1.4%
Passalidae
1.4%
Noctuidae
1.4%
Drosophilidae
1.4%
Stratiomyidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
1
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820214248 | Unclassified Kiritimatiellaeota Nt197P3bin16 | Isolate | Unclassified |
| 2 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 3 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 14 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 15 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 16 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 17 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 18 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 19 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 20 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 21 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 22 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 37 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 40 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 41 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 42 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 46 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 47 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 48 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 49 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 50 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 51 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 52 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 53 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 54 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 55 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 56 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 57 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 62 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 63 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 64 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 65 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 66 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 69 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 70 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 71 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 72 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 73 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_083526 | 3300042659 | Unclassified | 3700 |
| 2 | Ga0466710_357505 | 3300042613 | Bacteria | 5226 |
| 3 | Ga0466711_235523 | 3300042615 | Bacteria | 11905 |
| 4 | Ga0466726_076456 | 3300042619 | Bacteria | 4600 |
| 5 | Ga0466735_149908 | 3300042624 | Bacteria | 4781 |
| 6 | Ga0466702_054733 | 3300042635 | Bacteria | 23328 |
| 7 | Ga0466703_153683 | 3300042636 | Bacteria | 12256 |
| 8 | IMNBL1DRAFT_c0003653 | 3300000062 | Bacteria | 9701 |
| 9 | IMNBL1DRAFT_c0012653 | 3300000062 | Bacteria | 3843 |
| 10 | JGI24696J40584_12960045 | 3300002834 | Bacteria | 6171 |
| 11 | Ga0466714_022595 | 3300042603 | Bacteria | 225972 |
| 12 | Ga0466733_109830 | 3300042659 | Bacteria | 4280 |
| 13 | Ga0466733_153928 | 3300042659 | Bacteria | 4786 |
| 14 | Ga0466715_340147 | 3300042616 | Bacteria | 7430 |
| 15 | Ga0466734_031951 | 3300042623 | Bacteria | 1302 |
| 16 | Ga0466735_136972 | 3300042624 | Bacteria | 2921 |
| 17 | Ga0466725_094720 | 3300042654 | Bacteria | 12438 |
| 18 | Ga0466701_011095 | 3300042598 | Bacteria | 4335 |
| 19 | Ga0123356_10276915 | 3300010049 | Bacteria | 1771 |
| 20 | JGI24702J35022_10000819 | 3300002462 | Bacteria | 19235 |
| 21 | Ga0123357_10000687 | 3300009784 | Bacteria | 33859 |
| 22 | Ga0466716_007105 | 3300042605 | Bacteria | 2461 |
| 23 | Ga0466716_481844 | 3300042605 | Bacteria | 2483 |
| 24 | Ga0466705_019787 | 3300042612 | Bacteria | 48611 |
| 25 | Ga0466710_081240 | 3300042613 | Bacteria | 5037 |
| 26 | Ga0466718_118962 | 3300042617 | Bacteria | 5410 |
| 27 | Ga0466726_341867 | 3300042619 | Bacteria | 1133 |
| 28 | Ga0466703_002000 | 3300042636 | Bacteria | 9441 |
| 29 | Ga0123353_10481006 | 3300010167 | Unclassified | 1817 |
| 30 | Ga0123353_10601520 | 3300010167 | Bacteria | 1571 |
| 31 | Ga0123354_10000013 | 3300010882 | Bacteria | 155838 |
| 32 | JGI24702J35022_10025433 | 3300002462 | Bacteria | 3195 |
| 33 | Ga0466701_062451 | 3300042598 | Bacteria | 2215 |
| 34 | Ga0466698_515859 | 3300042610 | Bacteria | 1497 |
| 35 | Ga0466733_079907 | 3300042659 | Bacteria | 13546 |
| 36 | Ga0466723_284297 | 3300042618 | Bacteria | 7183 |
| 37 | Ga0466728_026287 | 3300042620 | Bacteria | 61001 |
| 38 | Ga0466703_148369 | 3300042636 | Bacteria | 14298 |
| 39 | Ga0466704_539615 | 3300042643 | Bacteria | 1481 |
| 40 | Ga0466727_273873 | 3300042655 | Bacteria | 1433 |
| 41 | Ga0466727_303321 | 3300042655 | Bacteria | 9370 |
| 42 | Ga0466693_143436 | 3300042592 | Bacteria | 8061 |
| 43 | Ga0466696_281938 | 3300042596 | Bacteria | 34413 |
| 44 | Ga0466706_064341 | 3300042599 | Bacteria | 2684 |
| 45 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 46 | Ga0466705_499593 | 3300042612 | Bacteria | 1472 |
| 47 | Ga0466726_009660 | 3300042619 | Bacteria | 122985 |
| 48 | Ga0466735_214303 | 3300042624 | Bacteria | 3719 |
| 49 | Ga0466704_464752 | 3300042643 | Bacteria | 1451 |
| 50 | Ga0466704_605489 | 3300042643 | Bacteria | 25005 |
| 51 | Ga0466709_012478 | 3300042648 | Bacteria | 5850 |
| 52 | Ga0466708_132513 | 3300042652 | Bacteria | 11004 |
| 53 | Ga0466696_044865 | 3300042596 | Bacteria | 2237 |
| 54 | JGI24702J35022_10004510 | 3300002462 | Bacteria | 8256 |
| 55 | Ga0068305_10751072 | 3300005083 | Bacteria | 1808 |
| 56 | Ga0466707_249618 | 3300042601 | Bacteria | 3270 |
| 57 | Ga0466713_013757 | 3300042602 | Bacteria | 111029 |
| 58 | Ga0466714_146526 | 3300042603 | Bacteria | 1262 |
| 59 | Ga0466716_156920 | 3300042605 | Bacteria | 1889 |
| 60 | Ga0466733_216697 | 3300042659 | Bacteria | 189231 |
| 61 | Ga0466715_151426 | 3300042616 | Bacteria | 5813 |
| 62 | Ga0466715_440006 | 3300042616 | Unclassified | 1893 |
| 63 | Ga0466730_014758 | 3300042625 | Bacteria | 2508 |
| 64 | Ga0466703_290804 | 3300042636 | Bacteria | 40290 |
| 65 | Ga0466704_101119 | 3300042643 | Bacteria | 3727 |
| 66 | Ga0466708_316758 | 3300042652 | Bacteria | 2420 |
| 67 | Ga0466727_075374 | 3300042655 | Bacteria | 9191 |
| 68 | Ga0265387_1005618 | 3300024582 | Bacteria | 1689 |
| 69 | Ga0466657_352607 | 3300042582 | Bacteria | 8224 |
| 70 | Ga0466690_046822 | 3300042590 | Bacteria | 24937 |
| 71 | Ga0466693_047648 | 3300042592 | Bacteria | 2894 |
| 72 | Ga0466691_166387 | 3300042593 | Bacteria | 7921 |
| 73 | Ga0123354_10016664 | 3300010882 | Bacteria | 11514 |
| 74 | Ga0466701_022817 | 3300042598 | Bacteria | 35399 |
| 75 | Ga0466717_065805 | 3300042604 | Bacteria | 2210 |
| 76 | Ga0466716_041067 | 3300042605 | Bacteria | 24843 |
| 77 | Ga0466711_166651 | 3300042615 | Bacteria | 3915 |
| 78 | Ga0466711_284048 | 3300042615 | Bacteria | 5987 |
| 79 | Ga0466711_324852 | 3300042615 | Bacteria | 33382 |
| 80 | Ga0466715_309862 | 3300042616 | Bacteria | 99913 |
| 81 | Ga0466704_530368 | 3300042643 | Bacteria | 12857 |
| 82 | Ga0466692_009392 | 3300042591 | Bacteria | 30126 |
| 83 | Ga0123353_10000022 | 3300010167 | Bacteria | 176395 |
| 84 | Ga0123353_10065262 | 3300010167 | Bacteria | 5844 |
| 85 | Ga0123353_10252817 | 3300010167 | Archaea | 2728 |
| 86 | JGI24702J35022_10020832 | 3300002462 | Bacteria | 3556 |
| 87 | JGI24705J35276_12223514 | 3300002504 | Bacteria | 2517 |
| 88 | JGI24699J35502_11134177 | 3300002509 | Bacteria | 45536 |
| 89 | Ga0068305_10047805 | 3300005083 | Bacteria | 10204 |
| 90 | Ga0072940_1193573 | 3300005200 | Bacteria | 2796 |
| 91 | Ga0466706_190032 | 3300042599 | Bacteria | 10887 |
| 92 | Ga0466707_014433 | 3300042601 | Bacteria | 6602 |
| 93 | Ga0466707_047027 | 3300042601 | Bacteria | 9021 |
| 94 | Ga0466713_089870 | 3300042602 | Bacteria | 67596 |
| 95 | Ga0466716_472743 | 3300042605 | Bacteria | 25011 |
| 96 | Ga0466698_061552 | 3300042610 | Bacteria | 1532 |
| 97 | Ga0466711_010847 | 3300042615 | Bacteria | 41256 |
| 98 | Ga0466711_125101 | 3300042615 | Bacteria | 20840 |
| 99 | Ga0466715_434645 | 3300042616 | Bacteria | 6659 |
| 100 | Ga0466729_299409 | 3300042621 | Bacteria | 5709 |
| 101 | Ga0466731_424603 | 3300042622 | Bacteria | 1367 |
| 102 | Ga0466703_126475 | 3300042636 | Bacteria | 6537 |
| 103 | Ga0466656_115662 | 3300042550 | Bacteria | 1821 |
| 104 | Ga0466690_055481 | 3300042590 | Bacteria | 72316 |
| 105 | Ga0466696_007670 | 3300042596 | Bacteria | 6499 |
| 106 | Ga0466696_245492 | 3300042596 | Bacteria | 11226 |
| 107 | JGI24695J34938_10000693 | 3300002450 | Bacteria | 31752 |
| 108 | JGI24702J35022_10012896 | 3300002462 | Bacteria | 4637 |
| 109 | JGI24702J35022_10204107 | 3300002462 | Bacteria | 1132 |
| 110 | Ga0466720_117633 | 3300042607 | Bacteria | 3421 |
| 111 | Ga0466720_225754 | 3300042607 | Bacteria | 2960 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005083 | Ga0068305_10751072 | Ga0068305_107510722 | 281 |
| 2 | 3300042652 | Ga0466708_132513 | Ga0466708_132513_5593_6495 | 283 |
| 3 | 3300042593 | Ga0466691_166387 | Ga0466691_166387_3155_4060 | 284 |
| 4 | 3300002462 | JGI24702J35022_10000819 | JGI24702J35022_100008195 | 286 |
| 5 | 3300042613 | Ga0466710_081240 | Ga0466710_081240_2885_3790 | 287 |
| 6 | 3300042648 | Ga0466709_012478 | Ga0466709_012478_4770_5678 | 287 |
| 7 | 3300042659 | Ga0466733_153928 | Ga0466733_153928_1025_1936 | 288 |
| 8 | 3300042605 | Ga0466716_156920 | Ga0466716_156920_99_1007 | 289 |
| 9 | 3300042622 | Ga0466731_424603 | Ga0466731_424603_300_1208 | 289 |
| 10 | 3300042635 | Ga0466702_054733 | Ga0466702_054733_6712_7623 | 289 |
| 11 | iso_pr_bacteria | 2820214248 | 2820214449 | 290 |
| 12 | iso_pr_bacteria | 2902668162 | 2902669152 | 290 |
| 13 | iso_pr_bacteria | 2523231078 | 2523495995 | 293 |
| 14 | 3300002504 | JGI24705J35276_12223514 | JGI24705J35276_122235142 | 295 |
| 15 | 3300010167 | Ga0123353_10601520 | Ga0123353_106015202 | 295 |
| 16 | 3300042620 | Ga0466728_026287 | Ga0466728_026287_12884_13795 | 296 |
| 17 | 3300042655 | Ga0466727_303321 | Ga0466727_303321_1177_2070 | 297 |
| 18 | 3300042616 | Ga0466715_434645 | Ga0466715_434645_4948_5850 | 300 |
| 19 | 3300010167 | Ga0123353_10065262 | Ga0123353_100652623 | 301 |
| 20 | 3300042592 | Ga0466693_047648 | Ga0466693_047648_1859_2764 | 301 |
| 21 | 3300042612 | Ga0466705_019787 | Ga0466705_019787_18829_19734 | 301 |
| 22 | 3300042616 | Ga0466715_151426 | Ga0466715_151426_1988_2893 | 301 |
| 23 | 3300042618 | Ga0466723_284297 | Ga0466723_284297_2978_3883 | 301 |
| 24 | 3300042624 | Ga0466735_149908 | Ga0466735_149908_83_1072 | 301 |
| 25 | 3300042636 | Ga0466703_126475 | Ga0466703_126475_2742_3647 | 301 |
| 26 | 3300042643 | Ga0466704_464752 | Ga0466704_464752_315_1220 | 301 |
| 27 | 3300042643 | Ga0466704_605489 | Ga0466704_605489_18587_19492 | 301 |
| 28 | iso_pr_bacteria | 8030343600 | 8030346818 | 301 |
| 29 | 3300010167 | Ga0123353_10252817 | Ga0123353_102528172 | 302 |
| 30 | 3300042590 | Ga0466690_055481 | Ga0466690_055481_18416_19324 | 302 |
| 31 | 3300042596 | Ga0466696_007670 | Ga0466696_007670_2912_3820 | 302 |
| 32 | 3300042601 | Ga0466707_249618 | Ga0466707_249618_1523_2431 | 302 |
| 33 | 3300042602 | Ga0466713_089870 | Ga0466713_089870_21345_22253 | 302 |
| 34 | 3300042603 | Ga0466714_146526 | Ga0466714_146526_59_967 | 302 |
| 35 | 3300042615 | Ga0466711_166651 | Ga0466711_166651_1410_2390 | 302 |
| 36 | 3300042636 | Ga0466703_153683 | Ga0466703_153683_8612_9520 | 302 |
| 37 | 3300042643 | Ga0466704_539615 | Ga0466704_539615_364_1320 | 302 |
| 38 | iso_pr_bacteria | 2820762746 | 2820764573 | 302 |
| 39 | 3300002509 | JGI24699J35502_11134177 | JGI24699J35502_1113417732 | 303 |
| 40 | 3300010882 | Ga0123354_10016664 | Ga0123354_100166649 | 303 |
| 41 | 3300024582 | Ga0265387_1005618 | Ga0265387_10056182 | 303 |
| 42 | 3300042602 | Ga0466713_013757 | Ga0466713_013757_74842_75753 | 303 |
| 43 | 3300042605 | Ga0466716_007105 | Ga0466716_007105_378_1289 | 303 |
| 44 | 3300042605 | Ga0466716_472743 | Ga0466716_472743_11213_12124 | 303 |
| 45 | 3300042610 | Ga0466698_061552 | Ga0466698_061552_57_968 | 303 |
| 46 | 3300042610 | Ga0466698_515859 | Ga0466698_515859_432_1343 | 303 |
| 47 | 3300042612 | Ga0466705_499593 | Ga0466705_499593_87_998 | 303 |
| 48 | 3300042613 | Ga0466710_357505 | Ga0466710_357505_3919_4830 | 303 |
| 49 | 3300042615 | Ga0466711_010847 | Ga0466711_010847_30705_31616 | 303 |
| 50 | 3300042615 | Ga0466711_125101 | Ga0466711_125101_17983_18894 | 303 |
| 51 | 3300042615 | Ga0466711_235523 | Ga0466711_235523_2889_3800 | 303 |
| 52 | 3300042615 | Ga0466711_324852 | Ga0466711_324852_24920_25831 | 303 |
| 53 | 3300042616 | Ga0466715_309862 | Ga0466715_309862_98672_99583 | 303 |
| 54 | 3300042616 | Ga0466715_440006 | Ga0466715_440006_813_1724 | 303 |
| 55 | 3300042621 | Ga0466729_299409 | Ga0466729_299409_2939_3850 | 303 |
| 56 | 3300042624 | Ga0466735_214303 | Ga0466735_214303_1295_2206 | 303 |
| 57 | 3300042625 | Ga0466730_014758 | Ga0466730_014758_268_1179 | 303 |
| 58 | 3300042636 | Ga0466703_002000 | Ga0466703_002000_5929_6840 | 303 |
| 59 | 3300042636 | Ga0466703_148369 | Ga0466703_148369_8550_9461 | 303 |
| 60 | 3300042652 | Ga0466708_316758 | Ga0466708_316758_266_1177 | 303 |
| 61 | 3300042654 | Ga0466725_094720 | Ga0466725_094720_7519_8430 | 303 |
| 62 | 3300042659 | Ga0466733_079907 | Ga0466733_079907_795_1706 | 303 |
| 63 | 3300042659 | Ga0466733_083526 | Ga0466733_083526_2625_3536 | 303 |
| 64 | 3300042659 | Ga0466733_109830 | Ga0466733_109830_2367_3278 | 303 |
| 65 | 3300042659 | Ga0466733_216697 | Ga0466733_216697_57084_57995 | 303 |
| 66 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_1251068_1251979 | 303 |
| 67 | iso_pr_bacteria | 2910926975 | 2910927673 | 303 |
| 68 | iso_pr_bacteria | 2910959314 | 2910960550 | 303 |
| 69 | iso_pr_bacteria | 2920168565 | 2920169935 | 303 |
| 70 | iso_pr_bacteria | 2923982719 | 2923983484 | 303 |
| 71 | iso_pr_bacteria | 2940216256 | 2940216272 | 303 |
| 72 | iso_pr_bacteria | 2940371297 | 2940371414 | 303 |
| 73 | iso_pr_bacteria | 8100166142 | 8100168460 | 303 |
| 74 | 3300000062 | IMNBL1DRAFT_c0003653 | IMNBL1DRAFT_00036536 | 304 |
| 75 | 3300000062 | IMNBL1DRAFT_c0012653 | IMNBL1DRAFT_00126533 | 304 |
| 76 | 3300002462 | JGI24702J35022_10004510 | JGI24702J35022_100045104 | 304 |
| 77 | 3300002462 | JGI24702J35022_10012896 | JGI24702J35022_100128962 | 304 |
| 78 | 3300002462 | JGI24702J35022_10020832 | JGI24702J35022_100208322 | 304 |
| 79 | 3300002462 | JGI24702J35022_10025433 | JGI24702J35022_100254332 | 304 |
| 80 | 3300002462 | JGI24702J35022_10204107 | JGI24702J35022_102041071 | 304 |
| 81 | 3300002834 | JGI24696J40584_12960045 | JGI24696J40584_129600453 | 304 |
| 82 | 3300009784 | Ga0123357_10000687 | Ga0123357_1000068711 | 304 |
| 83 | 3300042591 | Ga0466692_009392 | Ga0466692_009392_19774_20688 | 304 |
| 84 | 3300042596 | Ga0466696_044865 | Ga0466696_044865_1299_2213 | 304 |
| 85 | 3300042596 | Ga0466696_245492 | Ga0466696_245492_8787_9701 | 304 |
| 86 | 3300042599 | Ga0466706_064341 | Ga0466706_064341_1178_2092 | 304 |
| 87 | 3300042601 | Ga0466707_014433 | Ga0466707_014433_1125_2039 | 304 |
| 88 | 3300042605 | Ga0466716_041067 | Ga0466716_041067_15606_16520 | 304 |
| 89 | 3300042605 | Ga0466716_481844 | Ga0466716_481844_1233_2147 | 304 |
| 90 | 3300042619 | Ga0466726_076456 | Ga0466726_076456_1736_2650 | 304 |
| 91 | 3300042643 | Ga0466704_530368 | Ga0466704_530368_10179_11093 | 304 |
| 92 | 3300042582 | Ga0466657_352607 | Ga0466657_352607_4874_5791 | 305 |
| 93 | 3300042592 | Ga0466693_143436 | Ga0466693_143436_2492_3409 | 305 |
| 94 | 3300042596 | Ga0466696_281938 | Ga0466696_281938_5000_5917 | 305 |
| 95 | 3300042599 | Ga0466706_190032 | Ga0466706_190032_2944_3861 | 305 |
| 96 | 3300042604 | Ga0466717_065805 | Ga0466717_065805_686_1603 | 305 |
| 97 | 3300042619 | Ga0466726_009660 | Ga0466726_009660_44166_45083 | 305 |
| 98 | 3300042655 | Ga0466727_075374 | Ga0466727_075374_2641_3558 | 305 |
| 99 | iso_pr_bacteria | 2940195863 | 2940196745 | 305 |
| 100 | 3300005200 | Ga0072940_1193573 | Ga0072940_11935731 | 306 |
| 101 | 3300042601 | Ga0466707_047027 | Ga0466707_047027_1404_2324 | 306 |
| 102 | 3300010167 | Ga0123353_10481006 | Ga0123353_104810062 | 307 |
| 103 | 3300042590 | Ga0466690_046822 | Ga0466690_046822_2256_3179 | 307 |
| 104 | 3300042598 | Ga0466701_062451 | Ga0466701_062451_929_1852 | 307 |
| 105 | 3300042603 | Ga0466714_022595 | Ga0466714_022595_91359_92282 | 307 |
| 106 | 3300042623 | Ga0466734_031951 | Ga0466734_031951_207_1130 | 307 |
| 107 | 3300042655 | Ga0466727_273873 | Ga0466727_273873_467_1390 | 307 |
| 108 | iso_pr_bacteria | 641736255 | 641741362 | 307 |
| 109 | 3300010167 | Ga0123353_10000022 | Ga0123353_10000022107 | 308 |
| 110 | 3300010882 | Ga0123354_10000013 | Ga0123354_1000001329 | 308 |
| 111 | 3300042550 | Ga0466656_115662 | Ga0466656_115662_396_1322 | 308 |
| 112 | 3300042607 | Ga0466720_225754 | Ga0466720_225754_1530_2456 | 308 |
| 113 | 3300042598 | Ga0466701_022817 | Ga0466701_022817_16031_16963 | 310 |
| 114 | 3300042607 | Ga0466720_117633 | Ga0466720_117633_82_1014 | 310 |
| 115 | iso_pr_bacteria | 2551306396 | 2552920408 | 310 |
| 116 | iso_pr_bacteria | 2836667214 | 2836668159 | 310 |
| 117 | iso_pr_bacteria | 2849099867 | 2849101172 | 310 |
| 118 | iso_pr_bacteria | 2849104611 | 2849108163 | 310 |
| 119 | iso_pr_bacteria | 2850744690 | 2850747651 | 310 |
| 120 | iso_pr_bacteria | 2983866074 | 2983869084 | 310 |
| 121 | iso_pr_bacteria | 2827179085 | 2827184449 | 311 |
| 122 | iso_pr_bacteria | 2971438493 | 2971442942 | 311 |
| 123 | 3300042616 | Ga0466715_340147 | Ga0466715_340147_6323_7264 | 313 |
| 124 | 3300042619 | Ga0466726_341867 | Ga0466726_341867_53_997 | 314 |
| 125 | 3300042598 | Ga0466701_011095 | Ga0466701_011095_927_1874 | 315 |
| 126 | 3300005083 | Ga0068305_10047805 | Ga0068305_100478056 | 316 |
| 127 | 3300002450 | JGI24695J34938_10000693 | JGI24695J34938_100006938 | 317 |
| 128 | 3300042615 | Ga0466711_284048 | Ga0466711_284048_1697_2650 | 317 |
| 129 | 3300042617 | Ga0466718_118962 | Ga0466718_118962_2066_3019 | 317 |
| 130 | 3300042643 | Ga0466704_101119 | Ga0466704_101119_1220_2176 | 318 |
| 131 | 3300010049 | Ga0123356_10276915 | Ga0123356_102769151 | 319 |
| 132 | 3300042636 | Ga0466703_290804 | Ga0466703_290804_20474_21445 | 323 |
| 133 | 3300042624 | Ga0466735_136972 | Ga0466735_136972_353_1378 | 341 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01180 | DHO_dh | Dihydroorotate dehydrogenase | 29 | 326 | 0.93 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.