Protein Family IF08772
Metagenome
Isolate
144
Members
50
Samples
125
Scaffolds
448.31
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_074441|Ga0466735_074441_4233_5720
- Length
- 495 aa
- Sequence
- MEQFANIVSTIDGWLWGPWVLVWILPLTHVFMTVRTGFIQKKLLLGIKLSVTKDADGTGDVSQFGALTTALAATIGTGNIXXXXTAIARGGPGAVLWMWLMGVFGIATKYAESLIAVKYRVRTEDGTMLGGAMYALERGLKMKWLGVLFAVFAALASFGIGNGVQANAVATLLNETAPISITLTGIVNGDLGRSSVEIPIYITQLVAGAVMAVLVGMVILGGIKSISKVCIALVPFMALFYVFGCIVILVINHSYIFPAIALICKSAFSSDAATGGFVGFALSKAIQFGFSRGLFSNESGMGSAPIVAAAAKTRNPVRQALVSSTGTFWDTVLICLITGIVIISTVLAHPEINTGVVNGATLTHNAFMQITGFGPFVLTVALIVFAFSTILGWSYYGERCVAYLFGSKIIRNYRIIFVLVVFIGAIAPLDLAWNISDILNGLMTLPNIIAMILLSGVIAKETKKYLNNIDAIDADAIPLRTELIVKSKKGISSKE
Sample Types
Isolate
12.5%
Metagenome
87.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
28.6%
Kalotermitidae
28.6%
Termitidae
16.3%
Rhinotermitidae
8.2%
Unclassified
6.1%
Termopsidae
6.1%
Passalidae
4.1%
Hodotermitidae
2.0%
Taxonomy
Archaea
1
Bacteria
130
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 16 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 17 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 24 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 30 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 31 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 32 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 33 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 34 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 40 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 41 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 42 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 43 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 44 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 45 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 46 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 47 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_144242 | 3300042656 | Bacteria | 5065 |
| 2 | Ga0466723_190796 | 3300042618 | Bacteria | 36065 |
| 3 | Ga0466720_081271 | 3300042607 | Bacteria | 11222 |
| 4 | Ga0466722_083728 | 3300042609 | Archaea | 5498 |
| 5 | Ga0466722_126456 | 3300042609 | Bacteria | 11948 |
| 6 | Ga0466722_245527 | 3300042609 | Bacteria | 3091 |
| 7 | Ga0466696_053753 | 3300042596 | Bacteria | 23190 |
| 8 | JGI24698J34947_10016327 | 3300002449 | Bacteria | 4029 |
| 9 | Ga0466705_329237 | 3300042612 | Unclassified | 4332 |
| 10 | Ga0466708_273759 | 3300042652 | Bacteria | 6692 |
| 11 | Ga0466715_231994 | 3300042616 | Bacteria | 116561 |
| 12 | Ga0466718_124206 | 3300042617 | Bacteria | 3872 |
| 13 | Ga0466723_081892 | 3300042618 | Bacteria | 3524 |
| 14 | Ga0466723_157059 | 3300042618 | Bacteria | 28946 |
| 15 | Ga0466726_013733 | 3300042619 | Bacteria | 3156 |
| 16 | Ga0466726_086229 | 3300042619 | Bacteria | 3280 |
| 17 | Ga0466707_181235 | 3300042601 | Bacteria | 4322 |
| 18 | Ga0466716_162737 | 3300042605 | Unclassified | 1415 |
| 19 | Ga0466719_050328 | 3300042606 | Bacteria | 9303 |
| 20 | Ga0466719_104333 | 3300042606 | Bacteria | 1518 |
| 21 | Ga0466722_208582 | 3300042609 | Bacteria | 6537 |
| 22 | Ga0264413_114603 | 3300024493 | Bacteria | 3497 |
| 23 | Ga0466699_370719 | 3300042597 | Bacteria | 2096 |
| 24 | JGI24698J34947_10033833 | 3300002449 | Unclassified | 2679 |
| 25 | Ga0466704_333902 | 3300042643 | Bacteria | 5799 |
| 26 | Ga0466704_533539 | 3300042643 | Unclassified | 1905 |
| 27 | Ga0466704_547421 | 3300042643 | Unclassified | 5047 |
| 28 | Ga0466708_042747 | 3300042652 | Bacteria | 6856 |
| 29 | Ga0466708_189631 | 3300042652 | Bacteria | 13277 |
| 30 | Ga0466718_002314 | 3300042617 | Bacteria | 3295 |
| 31 | Ga0466726_086537 | 3300042619 | Bacteria | 2211 |
| 32 | Ga0466707_050143 | 3300042601 | Bacteria | 47469 |
| 33 | Ga0466690_030460 | 3300042590 | Unclassified | 2488 |
| 34 | Ga0466690_097433 | 3300042590 | Bacteria | 2195 |
| 35 | Ga0466690_251294 | 3300042590 | Bacteria | 2707 |
| 36 | Ga0466690_428655 | 3300042590 | Bacteria | 3195 |
| 37 | 2227471840 | 2225789004 | Bacteria | 23628 |
| 38 | Ga0466705_024358 | 3300042612 | Bacteria | 8180 |
| 39 | Ga0466705_083381 | 3300042612 | Unclassified | 14794 |
| 40 | Ga0466705_297989 | 3300042612 | Bacteria | 13597 |
| 41 | Ga0466704_239830 | 3300042643 | Bacteria | 1970 |
| 42 | Ga0466709_063956 | 3300042648 | Bacteria | 51970 |
| 43 | Ga0466727_095483 | 3300042655 | Bacteria | 2039 |
| 44 | Ga0466723_167541 | 3300042618 | Bacteria | 38557 |
| 45 | Ga0466726_066455 | 3300042619 | Bacteria | 1702 |
| 46 | Ga0466726_414479 | 3300042619 | Bacteria | 2091 |
| 47 | Ga0466707_209925 | 3300042601 | Unclassified | 13553 |
| 48 | Ga0466716_153987 | 3300042605 | Bacteria | 7351 |
| 49 | Ga0466716_156505 | 3300042605 | Bacteria | 5088 |
| 50 | Ga0456237_0001752 | 3300041968 | Bacteria | 3493 |
| 51 | Ga0466692_163242 | 3300042591 | Bacteria | 2842 |
| 52 | Ga0466691_158932 | 3300042593 | Bacteria | 22865 |
| 53 | IMNBL1DRAFT_c0001114 | 3300000062 | Bacteria | 20562 |
| 54 | Ga0466735_080173 | 3300042624 | Bacteria | 1417 |
| 55 | Ga0466704_069484 | 3300042643 | Bacteria | 11775 |
| 56 | Ga0466704_092710 | 3300042643 | Bacteria | 12460 |
| 57 | Ga0466704_353863 | 3300042643 | Bacteria | 5701 |
| 58 | Ga0466727_247762 | 3300042655 | Unclassified | 5079 |
| 59 | Ga0466727_266312 | 3300042655 | Bacteria | 2213 |
| 60 | Ga0466711_178331 | 3300042615 | Bacteria | 10418 |
| 61 | Ga0466715_134057 | 3300042616 | Bacteria | 12584 |
| 62 | Ga0466715_561450 | 3300042616 | Bacteria | 11347 |
| 63 | Ga0466726_098213 | 3300042619 | Bacteria | 3321 |
| 64 | Ga0466726_228104 | 3300042619 | Bacteria | 6535 |
| 65 | Ga0466706_175662 | 3300042599 | Bacteria | 3937 |
| 66 | Ga0466713_027922 | 3300042602 | Bacteria | 99091 |
| 67 | Ga0466720_076660 | 3300042607 | Bacteria | 19001 |
| 68 | Ga0264413_103863 | 3300024493 | Bacteria | 13916 |
| 69 | Ga0466690_082146 | 3300042590 | Bacteria | 2590 |
| 70 | Ga0466691_035184 | 3300042593 | Bacteria | 9555 |
| 71 | Ga0466691_141392 | 3300042593 | Bacteria | 3504 |
| 72 | 2227158567 | 2225789004 | Bacteria | 8427 |
| 73 | 2227485756 | 2225789004 | Bacteria | 21150 |
| 74 | AustNasuHG_c1000218 | 3300000089 | Bacteria | 19111 |
| 75 | Ga0068305_10024037 | 3300005083 | Unclassified | 12122 |
| 76 | Ga0466729_217761 | 3300042621 | Bacteria | 50786 |
| 77 | Ga0466703_314025 | 3300042636 | Bacteria | 11407 |
| 78 | Ga0466703_389215 | 3300042636 | Bacteria | 42403 |
| 79 | Ga0466723_312197 | 3300042618 | Bacteria | 11558 |
| 80 | Ga0466707_064034 | 3300042601 | Unclassified | 8248 |
| 81 | Ga0466707_188924 | 3300042601 | Bacteria | 7766 |
| 82 | Ga0466716_140831 | 3300042605 | Bacteria | 6819 |
| 83 | Ga0466720_225752 | 3300042607 | Bacteria | 13816 |
| 84 | Ga0466722_166494 | 3300042609 | Bacteria | 11065 |
| 85 | Ga0466690_052917 | 3300042590 | Unclassified | 10043 |
| 86 | Ga0466694_087954 | 3300042594 | Bacteria | 6826 |
| 87 | Ga0068305_10012225 | 3300005083 | Bacteria | 7074 |
| 88 | Ga0074263_104116 | 3300005485 | Bacteria | 2536 |
| 89 | Ga0466735_074441 | 3300042624 | Bacteria | 13324 |
| 90 | Ga0466703_048543 | 3300042636 | Bacteria | 11129 |
| 91 | Ga0466703_420457 | 3300042636 | Bacteria | 2589 |
| 92 | Ga0466704_251062 | 3300042643 | Bacteria | 2991 |
| 93 | Ga0466709_126675 | 3300042648 | Bacteria | 69442 |
| 94 | Ga0466708_347213 | 3300042652 | Bacteria | 2136 |
| 95 | Ga0466727_139194 | 3300042655 | Bacteria | 19736 |
| 96 | Ga0466705_423846 | 3300042612 | Bacteria | 6421 |
| 97 | Ga0466711_360309 | 3300042615 | Bacteria | 3458 |
| 98 | Ga0466715_239863 | 3300042616 | Bacteria | 10056 |
| 99 | Ga0466706_221283 | 3300042599 | Bacteria | 43471 |
| 100 | Ga0466713_000549 | 3300042602 | Bacteria | 6653 |
| 101 | Ga0466713_075763 | 3300042602 | Bacteria | 37516 |
| 102 | Ga0466716_187708 | 3300042605 | Bacteria | 2019 |
| 103 | Ga0466722_239349 | 3300042609 | Bacteria | 5086 |
| 104 | Ga0466692_082541 | 3300042591 | Bacteria | 22010 |
| 105 | Ga0068305_10087375 | 3300005083 | Bacteria | 5435 |
| 106 | Ga0466704_111979 | 3300042643 | Bacteria | 2534 |
| 107 | Ga0466704_133979 | 3300042643 | Bacteria | 31511 |
| 108 | Ga0466704_551181 | 3300042643 | Bacteria | 3972 |
| 109 | Ga0466727_176063 | 3300042655 | Bacteria | 1757 |
| 110 | Ga0466715_412803 | 3300042616 | Bacteria | 5673 |
| 111 | Ga0466723_108600 | 3300042618 | Bacteria | 8461 |
| 112 | Ga0466728_121185 | 3300042620 | Bacteria | 4944 |
| 113 | Ga0466713_153672 | 3300042602 | Unclassified | 7006 |
| 114 | Ga0466716_027124 | 3300042605 | Bacteria | 1818 |
| 115 | Ga0466716_382194 | 3300042605 | Bacteria | 4604 |
| 116 | Ga0466719_069854 | 3300042606 | Bacteria | 6615 |
| 117 | Ga0466720_021337 | 3300042607 | Bacteria | 9772 |
| 118 | Ga0466720_022537 | 3300042607 | Bacteria | 11283 |
| 119 | Ga0466722_039326 | 3300042609 | Bacteria | 5870 |
| 120 | Ga0466722_156644 | 3300042609 | Bacteria | 1891 |
| 121 | Ga0466696_077829 | 3300042596 | Bacteria | 45805 |
| 122 | Ga0466696_424707 | 3300042596 | Bacteria | 44406 |
| 123 | AustNasuHG_c1014419 | 3300000089 | Bacteria | 2689 |
| 124 | Ga0466708_399382 | 3300042652 | Bacteria | 34348 |
| 125 | Ga0466727_228411 | 3300042655 | Bacteria | 2132 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01235 | Na_Ala_symp | Sodium:alanine symporter family | 52 | 469 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.