Protein Family IF08745
Metagenome
Isolate
273
Members
98
Samples
237
Scaffolds
323.79
Avg Length
Representative Sequence
- ID
- 3300042624|Ga0466735_045784|Ga0466735_045784_807_1910
- Length
- 367 aa
- Sequence
- MINPVPAIAQLGETKNYTVSLCLPRSGGTSVVISKIVNKNQMKTFNEISQIIETELAAINWHREPYGLYAPVEYVLSLGGKRIRPALVLMGCNLFTDNVLPALKPAVGVEIFHNFTLLHDDIMDKAPVRRGKPTVHLKWNENAAILSGDLMQIEAYKYIAAAPQNVLKQVIDAFSQTAAEVCEGQQMDMDFEKRDSITEVEYLEMIRLKTAVLLGGALKIGAFVGNSEFDDIEQLEKFGTNIGMAFQLKDDLLDVYGDEQTFGKQIGGDILCNKKTLLLIYALELAKNADAEKLTELLNNHKDKFSPSEKISAVTDIYNKLKIRALCEEKMNFYFEQALKNLEEVKVENVKKTELLSLAKKLMCRID
Sample Types
Isolate
13.2%
Metagenome
86.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.3%
Blattidae
21.7%
Kalotermitidae
15.2%
Unclassified
12.0%
Termopsidae
4.3%
Rhinotermitidae
4.3%
Drosophilidae
3.3%
Passalidae
3.3%
Formicidae
1.1%
Armadillidiidae
1.1%
Hodotermitidae
1.1%
Apidae
1.1%
Elmidae
1.1%
Bombycidae
1.1%
Culicidae
1.1%
Taxonomy
Archaea
1
Bacteria
261
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 2 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 3 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 4 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 5 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 6 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 13 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 14 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 15 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 16 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 17 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 20 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 25 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 34 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 35 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 36 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 37 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 38 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 46 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 49 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 50 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 51 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 52 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 53 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 54 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 55 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 58 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 59 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 60 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 61 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 62 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 63 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 64 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 65 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 66 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 67 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 68 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 69 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 70 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 71 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 72 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 73 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 74 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 75 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 76 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 77 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 78 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 79 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 80 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 81 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 82 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 83 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 84 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 85 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 86 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 87 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 88 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 89 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 90 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 91 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 92 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 93 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 94 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 95 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 96 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 97 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 98 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_019476 | 3300042612 | Bacteria | 24974 |
| 2 | Ga0466701_075975 | 3300042598 | Bacteria | 4602 |
| 3 | Ga0466706_113167 | 3300042599 | Bacteria | 48207 |
| 4 | Ga0466706_113743 | 3300042599 | Bacteria | 22186 |
| 5 | Ga0466706_225634 | 3300042599 | Bacteria | 10986 |
| 6 | Ga0466707_146944 | 3300042601 | Bacteria | 2483 |
| 7 | Ga0466707_379163 | 3300042601 | Bacteria | 4317 |
| 8 | Ga0466713_068335 | 3300042602 | Bacteria | 13426 |
| 9 | Ga0466716_484837 | 3300042605 | Bacteria | 30730 |
| 10 | Ga0466719_119717 | 3300042606 | Bacteria | 17932 |
| 11 | Ga0466719_191287 | 3300042606 | Bacteria | 3003 |
| 12 | Ga0466719_569291 | 3300042606 | Bacteria | 10269 |
| 13 | Ga0466690_039968 | 3300042590 | Bacteria | 9494 |
| 14 | Ga0466690_165311 | 3300042590 | Bacteria | 2432 |
| 15 | Ga0466690_165346 | 3300042590 | Bacteria | 12704 |
| 16 | Ga0466690_310023 | 3300042590 | Bacteria | 1051 |
| 17 | Ga0466691_006630 | 3300042593 | Bacteria | 10750 |
| 18 | Ga0466691_127886 | 3300042593 | Bacteria | 16442 |
| 19 | Ga0466696_061891 | 3300042596 | Bacteria | 14268 |
| 20 | Ga0466696_215903 | 3300042596 | Bacteria | 16708 |
| 21 | Ga0466703_013553 | 3300042636 | Bacteria | 20328 |
| 22 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 23 | Ga0466703_098615 | 3300042636 | Bacteria | 2714 |
| 24 | Ga0466703_202519 | 3300042636 | Bacteria | 22773 |
| 25 | Ga0466703_356965 | 3300042636 | Bacteria | 5558 |
| 26 | Ga0466724_47341 | 3300042649 | Bacteria | 42552 |
| 27 | Ga0466708_066300 | 3300042652 | Bacteria | 36627 |
| 28 | Ga0466708_299188 | 3300042652 | Bacteria | 34210 |
| 29 | Ga0123355_10000161 | 3300009826 | Bacteria | 81946 |
| 30 | Ga0123353_10000120 | 3300010167 | Bacteria | 93172 |
| 31 | 2227596036 | 2225789004 | Bacteria | 2379 |
| 32 | IMNBL1DRAFT_c0029107 | 3300000062 | Unclassified | 2049 |
| 33 | Ga0072940_1206393 | 3300005200 | Bacteria | 2226 |
| 34 | Ga0072941_1563818 | 3300005201 | Bacteria | 1572 |
| 35 | Ga0466710_275720 | 3300042613 | Bacteria | 8260 |
| 36 | Ga0466711_053834 | 3300042615 | Bacteria | 10425 |
| 37 | Ga0466711_154251 | 3300042615 | Bacteria | 6424 |
| 38 | Ga0466723_163253 | 3300042618 | Unclassified | 7610 |
| 39 | Ga0466726_140521 | 3300042619 | Bacteria | 4869 |
| 40 | Ga0466733_005554 | 3300042659 | Bacteria | 5236 |
| 41 | Ga0466733_186177 | 3300042659 | Bacteria | 18387 |
| 42 | Ga0466733_217934 | 3300042659 | Bacteria | 2835 |
| 43 | Ga0466706_126637 | 3300042599 | Bacteria | 4190 |
| 44 | Ga0466706_165313 | 3300042599 | Bacteria | 60368 |
| 45 | Ga0466707_198027 | 3300042601 | Bacteria | 2976 |
| 46 | Ga0466716_041136 | 3300042605 | Bacteria | 2794 |
| 47 | Ga0466716_209321 | 3300042605 | Bacteria | 10671 |
| 48 | Ga0466719_068358 | 3300042606 | Bacteria | 7078 |
| 49 | Ga0466719_496268 | 3300042606 | Bacteria | 6314 |
| 50 | Ga0466690_402356 | 3300042590 | Bacteria | 64397 |
| 51 | Ga0466692_015079 | 3300042591 | Bacteria | 1732 |
| 52 | Ga0466691_045847 | 3300042593 | Bacteria | 49393 |
| 53 | Ga0466735_204754 | 3300042624 | Bacteria | 1350 |
| 54 | Ga0466704_393392 | 3300042643 | Bacteria | 8481 |
| 55 | Ga0466724_20547 | 3300042649 | Unclassified | 7700 |
| 56 | Ga0466708_172242 | 3300042652 | Bacteria | 10802 |
| 57 | Ga0123353_10000067 | 3300010167 | Bacteria | 114305 |
| 58 | IMNBL1DRAFT_c0003807 | 3300000062 | Bacteria | 9410 |
| 59 | Ga0068305_10005585 | 3300005083 | Bacteria | 21211 |
| 60 | Ga0068305_10017836 | 3300005083 | Bacteria | 19003 |
| 61 | Ga0068305_10624827 | 3300005083 | Bacteria | 2981 |
| 62 | Ga0103267_1000692 | 3300007190 | Bacteria | 9247 |
| 63 | Ga0466711_333670 | 3300042615 | Bacteria | 2397 |
| 64 | Ga0466711_517535 | 3300042615 | Bacteria | 2401 |
| 65 | Ga0466715_507556 | 3300042616 | Bacteria | 8325 |
| 66 | Ga0466726_005153 | 3300042619 | Bacteria | 16947 |
| 67 | Ga0466726_341381 | 3300042619 | Bacteria | 1791 |
| 68 | Ga0466728_129505 | 3300042620 | Bacteria | 6012 |
| 69 | Ga0466728_244893 | 3300042620 | Bacteria | 24303 |
| 70 | Ga0466705_042664 | 3300042612 | Bacteria | 9928 |
| 71 | Ga0466705_280937 | 3300042612 | Bacteria | 8395 |
| 72 | Ga0466713_137499 | 3300042602 | Bacteria | 46639 |
| 73 | Ga0415639_017097 | 3300038395 | Bacteria | 1497 |
| 74 | Ga0466656_169295 | 3300042550 | Bacteria | 1645 |
| 75 | Ga0466690_305294 | 3300042590 | Bacteria | 13677 |
| 76 | Ga0466694_214993 | 3300042594 | Bacteria | 1606 |
| 77 | Ga0466695_290486 | 3300042595 | Bacteria | 5398 |
| 78 | Ga0466696_229205 | 3300042596 | Bacteria | 18722 |
| 79 | Ga0466735_081009 | 3300042624 | Bacteria | 11986 |
| 80 | Ga0466730_054806 | 3300042625 | Bacteria | 801523 |
| 81 | Ga0466703_001595 | 3300042636 | Bacteria | 18307 |
| 82 | Ga0466704_247905 | 3300042643 | Bacteria | 30308 |
| 83 | Ga0466704_533188 | 3300042643 | Bacteria | 20326 |
| 84 | Ga0466727_179059 | 3300042655 | Bacteria | 12208 |
| 85 | Ga0466727_198937 | 3300042655 | Bacteria | 6813 |
| 86 | Ga0123357_10176686 | 3300009784 | Bacteria | 2508 |
| 87 | Ga0123353_10217419 | 3300010167 | Bacteria | 2992 |
| 88 | Ga0123353_10277995 | 3300010167 | Bacteria | 2574 |
| 89 | Ga0123353_10928458 | 3300010167 | Unclassified | 1181 |
| 90 | 2227330804 | 2225789004 | Unclassified | 6326 |
| 91 | 2227536338 | 2225789004 | Bacteria | 3062 |
| 92 | Ga0068305_10130866 | 3300005083 | Unclassified | 8094 |
| 93 | Ga0104045_1082483 | 3300007085 | Bacteria | 1052 |
| 94 | Ga0104019_1002925 | 3300007150 | Bacteria | 5230 |
| 95 | Ga0103267_1000516 | 3300007190 | Bacteria | 11714 |
| 96 | Ga0466711_373737 | 3300042615 | Bacteria | 78112 |
| 97 | Ga0466711_395801 | 3300042615 | Bacteria | 1676 |
| 98 | Ga0466715_106265 | 3300042616 | Bacteria | 12571 |
| 99 | Ga0466715_292125 | 3300042616 | Bacteria | 7456 |
| 100 | Ga0466723_016908 | 3300042618 | Bacteria | 23913 |
| 101 | Ga0466723_354948 | 3300042618 | Bacteria | 23912 |
| 102 | Ga0466733_002151 | 3300042659 | Bacteria | 71476 |
| 103 | Ga0466733_010056 | 3300042659 | Bacteria | 20477 |
| 104 | Ga0466713_037887 | 3300042602 | Bacteria | 30344 |
| 105 | Ga0466713_043076 | 3300042602 | Bacteria | 16335 |
| 106 | Ga0466716_264353 | 3300042605 | Bacteria | 37115 |
| 107 | Ga0466697_039823 | 3300042611 | Unclassified | 1263 |
| 108 | Ga0466690_389175 | 3300042590 | Bacteria | 15062 |
| 109 | Ga0466691_016788 | 3300042593 | Bacteria | 2359 |
| 110 | Ga0466691_085284 | 3300042593 | Bacteria | 13430 |
| 111 | Ga0466694_124331 | 3300042594 | Bacteria | 1346 |
| 112 | Ga0466696_014642 | 3300042596 | Bacteria | 5725 |
| 113 | Ga0466696_474988 | 3300042596 | Bacteria | 2029 |
| 114 | Ga0466731_343280 | 3300042622 | Bacteria | 1801 |
| 115 | Ga0466703_209026 | 3300042636 | Bacteria | 32874 |
| 116 | Ga0466704_553498 | 3300042643 | Bacteria | 9951 |
| 117 | Ga0466708_010169 | 3300042652 | Bacteria | 14357 |
| 118 | Ga0466727_139768 | 3300042655 | Bacteria | 4090 |
| 119 | Ga0123355_10500493 | 3300009826 | Bacteria | 1499 |
| 120 | Ga0123356_10233289 | 3300010049 | Bacteria | 1906 |
| 121 | Ga0123354_10001081 | 3300010882 | Bacteria | 31466 |
| 122 | 2227035903 | 2225789003 | Bacteria | 22328 |
| 123 | 2227087775 | 2225789004 | Bacteria | 1848 |
| 124 | JGI24702J35022_10004904 | 3300002462 | Bacteria | 7888 |
| 125 | Ga0104050_1002980 | 3300007153 | Bacteria | 8380 |
| 126 | Ga0466715_350734 | 3300042616 | Bacteria | 3205 |
| 127 | Ga0466715_376227 | 3300042616 | Bacteria | 52075 |
| 128 | Ga0466715_496574 | 3300042616 | Bacteria | 33816 |
| 129 | Ga0466715_591652 | 3300042616 | Bacteria | 5296 |
| 130 | Ga0466726_441539 | 3300042619 | Bacteria | 2873 |
| 131 | Ga0466728_082650 | 3300042620 | Bacteria | 29100 |
| 132 | Ga0466729_175636 | 3300042621 | Bacteria | 14158 |
| 133 | Ga0466732_258064 | 3300042656 | Bacteria | 2846 |
| 134 | Ga0466700_038513 | 3300042600 | Bacteria | 4276 |
| 135 | Ga0466713_047540 | 3300042602 | Bacteria | 17647 |
| 136 | Ga0466713_066524 | 3300042602 | Bacteria | 14976 |
| 137 | Ga0466714_127121 | 3300042603 | Bacteria | 69480 |
| 138 | Ga0466719_306511 | 3300042606 | Bacteria | 3848 |
| 139 | Ga0466656_039996 | 3300042550 | Bacteria | 11141 |
| 140 | Ga0466656_122777 | 3300042550 | Bacteria | 11394 |
| 141 | Ga0466657_073923 | 3300042582 | Bacteria | 2571 |
| 142 | Ga0466690_019839 | 3300042590 | Bacteria | 17453 |
| 143 | Ga0466704_086945 | 3300042643 | Bacteria | 1387 |
| 144 | Ga0466725_089078 | 3300042654 | Bacteria | 11624 |
| 145 | Ga0466725_167604 | 3300042654 | Bacteria | 14927 |
| 146 | Ga0123355_10000217 | 3300009826 | Bacteria | 72204 |
| 147 | IMNBL1DRAFT_c0000935 | 3300000062 | Bacteria | 22566 |
| 148 | JGI24702J35022_10000916 | 3300002462 | Bacteria | 18359 |
| 149 | JGI24702J35022_10004055 | 3300002462 | Bacteria | 8770 |
| 150 | JGI24702J35022_10007653 | 3300002462 | Bacteria | 6174 |
| 151 | JGI24702J35022_10108932 | 3300002462 | Bacteria | 1522 |
| 152 | JGI24696J40584_12957290 | 3300002834 | Bacteria | 3442 |
| 153 | Ga0466705_079919 | 3300042612 | Unclassified | 2558 |
| 154 | Ga0466733_048728 | 3300042659 | Bacteria | 24602 |
| 155 | Ga0466733_049047 | 3300042659 | Bacteria | 7269 |
| 156 | Ga0466733_131111 | 3300042659 | Bacteria | 2118 |
| 157 | Ga0466706_054670 | 3300042599 | Bacteria | 52813 |
| 158 | Ga0466706_094705 | 3300042599 | Bacteria | 26280 |
| 159 | Ga0466706_095663 | 3300042599 | Bacteria | 79833 |
| 160 | Ga0466706_222726 | 3300042599 | Bacteria | 13277 |
| 161 | Ga0466713_051835 | 3300042602 | Bacteria | 22498 |
| 162 | Ga0466719_141427 | 3300042606 | Bacteria | 2527 |
| 163 | Ga0160436_1006175 | 3300012861 | Bacteria | 2791 |
| 164 | Ga0466690_425264 | 3300042590 | Bacteria | 16300 |
| 165 | Ga0466691_202614 | 3300042593 | Bacteria | 19692 |
| 166 | Ga0466696_485651 | 3300042596 | Bacteria | 2233 |
| 167 | Ga0466701_005018 | 3300042598 | Bacteria | 22866 |
| 168 | Ga0466735_033779 | 3300042624 | Bacteria | 1755 |
| 169 | Ga0466735_045784 | 3300042624 | Bacteria | 2085 |
| 170 | Ga0466704_003070 | 3300042643 | Bacteria | 12245 |
| 171 | Ga0466709_346172 | 3300042648 | Bacteria | 19067 |
| 172 | Ga0466708_450992 | 3300042652 | Bacteria | 19920 |
| 173 | Ga0068302_10096935 | 3300005071 | Bacteria | 2357 |
| 174 | Ga0068302_10259973 | 3300005071 | Unclassified | 2035 |
| 175 | Ga0068305_10029560 | 3300005083 | Bacteria | 6769 |
| 176 | Ga0103267_1000220 | 3300007190 | Bacteria | 22231 |
| 177 | Ga0466711_151335 | 3300042615 | Bacteria | 6386 |
| 178 | Ga0466715_270348 | 3300042616 | Unclassified | 1898 |
| 179 | Ga0466723_030264 | 3300042618 | Bacteria | 6780 |
| 180 | Ga0466723_093881 | 3300042618 | Bacteria | 35007 |
| 181 | Ga0466729_086294 | 3300042621 | Bacteria | 7760 |
| 182 | Ga0466705_027581 | 3300042612 | Bacteria | 2971 |
| 183 | Ga0466733_078798 | 3300042659 | Bacteria | 2423 |
| 184 | Ga0466714_030140 | 3300042603 | Bacteria | 39149 |
| 185 | Ga0466716_471309 | 3300042605 | Bacteria | 4850 |
| 186 | Ga0466656_337745 | 3300042550 | Bacteria | 2322 |
| 187 | Ga0466692_088175 | 3300042591 | Archaea | 4314 |
| 188 | Ga0466696_030834 | 3300042596 | Bacteria | 11783 |
| 189 | Ga0466734_108484 | 3300042623 | Bacteria | 3746 |
| 190 | Ga0466703_254148 | 3300042636 | Bacteria | 23220 |
| 191 | Ga0466704_080074 | 3300042643 | Bacteria | 18633 |
| 192 | Ga0466704_325172 | 3300042643 | Bacteria | 7320 |
| 193 | Ga0466704_334934 | 3300042643 | Bacteria | 2284 |
| 194 | Ga0466709_101953 | 3300042648 | Bacteria | 13846 |
| 195 | Ga0466709_297313 | 3300042648 | Bacteria | 3466 |
| 196 | Ga0466724_14560 | 3300042649 | Bacteria | 6718 |
| 197 | Ga0466708_076108 | 3300042652 | Bacteria | 112124 |
| 198 | Ga0123356_10023826 | 3300010049 | Bacteria | 5760 |
| 199 | Ga0160466_100046 | 3300012809 | Bacteria | 160488 |
| 200 | 2227205792 | 2225789004 | Bacteria | 7707 |
| 201 | JGI24702J35022_10000138 | 3300002462 | Bacteria | 36376 |
| 202 | JGI24705J35276_12237129 | 3300002504 | Unclassified | 9922 |
| 203 | Ga0068305_10002622 | 3300005083 | Bacteria | 23954 |
| 204 | Ga0068305_10019732 | 3300005083 | Bacteria | 5522 |
| 205 | Ga0466710_240403 | 3300042613 | Bacteria | 2091 |
| 206 | Ga0466711_147124 | 3300042615 | Bacteria | 8613 |
| 207 | Ga0466711_265420 | 3300042615 | Bacteria | 8423 |
| 208 | Ga0466711_398384 | 3300042615 | Bacteria | 15110 |
| 209 | Ga0466711_517683 | 3300042615 | Bacteria | 6340 |
| 210 | Ga0466715_341409 | 3300042616 | Bacteria | 7051 |
| 211 | Ga0466723_200901 | 3300042618 | Bacteria | 13167 |
| 212 | Ga0466729_065684 | 3300042621 | Bacteria | 3451 |
| 213 | Ga0466705_077990 | 3300042612 | Bacteria | 24079 |
| 214 | Ga0466706_022783 | 3300042599 | Bacteria | 4271 |
| 215 | Ga0466707_379726 | 3300042601 | Bacteria | 3108 |
| 216 | Ga0466719_296592 | 3300042606 | Bacteria | 8836 |
| 217 | Ga0466722_057340 | 3300042609 | Bacteria | 10007 |
| 218 | Ga0466722_180609 | 3300042609 | Bacteria | 4462 |
| 219 | Ga0160467_100441 | 3300012829 | Bacteria | 41404 |
| 220 | Ga0466657_005592 | 3300042582 | Bacteria | 12517 |
| 221 | Ga0466734_103983 | 3300042623 | Bacteria | 1821 |
| 222 | Ga0466703_048823 | 3300042636 | Bacteria | 16130 |
| 223 | Ga0466703_237479 | 3300042636 | Bacteria | 23006 |
| 224 | Ga0466704_485863 | 3300042643 | Bacteria | 9424 |
| 225 | Ga0466724_24755 | 3300042649 | Bacteria | 72335 |
| 226 | Ga0466708_372311 | 3300042652 | Bacteria | 12035 |
| 227 | Ga0466727_040337 | 3300042655 | Bacteria | 31698 |
| 228 | Ga0123353_10202185 | 3300010167 | Bacteria | 3124 |
| 229 | Ga0123353_10485465 | 3300010167 | Bacteria | 1806 |
| 230 | JGI24702J35022_10114788 | 3300002462 | Bacteria | 1483 |
| 231 | JGI24705J35276_12236165 | 3300002504 | Bacteria | 7586 |
| 232 | Ga0123357_10000239 | 3300009784 | Bacteria | 52222 |
| 233 | Ga0466710_082395 | 3300042613 | Bacteria | 9632 |
| 234 | Ga0466711_285989 | 3300042615 | Bacteria | 7430 |
| 235 | Ga0466715_173384 | 3300042616 | Bacteria | 14345 |
| 236 | Ga0466715_204293 | 3300042616 | Bacteria | 67582 |
| 237 | Ga0466728_440090 | 3300042620 | Bacteria | 2873 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00348 | polyprenyl_synt | Polyprenyl synthetase | 68 | 304 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00348 | GO:0008299 | isoprenoid biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.