Protein Family IF08686

Metagenome Isolate
235 Members
186 Samples
123 Scaffolds
253.08 Avg Length

🧬 Representative Sequence

ID
3300042623|Ga0466734_108061|Ga0466734_108061_2267_3130
Length
287 aa
Sequence
MVFQCADNGGVASSFLGGFSRTIEDGLTEISMVSNVVVAIPSRYSASRLPGKPLRLLAGEPLIVHVVRRALEAQPCEVWVATDDARIGDILSTSGARVAMTSGEHASGTDRLAECADIAGWADDTIVVNLQGDEPFAPASGIRAVTEALTNSRAEMATLAEPIFDTAILFDPNTVKVVRTTTGEALYFSRAPIPWHRDDFARGEQTLSLAGEWLRHIGIYAYRAGFLRRFTKMPPSRLERIESLEQLRVLEAGLPISVALSPEPFPPGVDTEKDLAHAEIYLQERIR

📊 Sample Types

Isolate 47.7%
Metagenome 52.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.1%
Formicidae 9.3%
Termitidae 8.1%
Apidae 5.8%
Elmidae 4.1%
Armadillidiidae 4.1%
Culicidae 4.1%
Kalotermitidae 3.5%
Curculionidae 3.5%
Sarcophagidae 2.3%
Drosophilidae 1.7%
Talitridae 1.7%
Palinuridae 1.7%
Aphididae 1.2%
Majidae 1.2%
Termopsidae 1.2%
Trigoniulidae 0.6%
Nephropidae 0.6%
Penaeidae 0.6%
Rhinotermitidae 0.6%
Siricidae 0.6%
Passalidae 0.6%
Calliphoridae 0.6%
Stratiomyidae 0.6%
Artemiidae 0.6%
Kiwaidae 0.6%
Cixiidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 225
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2507262005 Candidatus Regiella insecticola R5.15 Isolate Aphididae
2 2511231129 Vibrio sp. EJY3 Isolate Unclassified
3 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
4 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
5 2693429575 Vibrio parahaemolyticus ISF-54-12 Isolate Unclassified
6 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
7 2831380896 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
8 2864761044 Stenotrophomonas rhizophilia S00008 Isolate Elmidae
9 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
10 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
11 2908136803 Vibrio owensii 1700302 Isolate Unclassified
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
16 640963010 Vibrio harveyi HY01 Isolate Unclassified
17 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
18 8022345672 Vibrio sp. 070316B Isolate Unclassified
19 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
20 8100455565 Delftia sp. S67 Isolate Curculionidae
21 2997380424 Vibrio parahaemolyticus MVP1 Isolate Unclassified
22 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
23 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
24 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
25 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
26 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
27 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
28 2609459925 Vibrio nigripulchritudo SO65 Isolate Unclassified
29 2627853677 Vibrio nigripulchritudo FTn2 Isolate Unclassified
30 2648501628 Xanthomonas sp. Cag60 Isolate Unclassified
31 2684622551 Vibrio campbellii E1 Isolate Unclassified
32 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
33 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
34 2864791955 Aeromonas veronii S00030 Isolate Elmidae
35 2875320051 Vibrio parahaemolyticus 160807 Isolate Unclassified
36 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
37 2877647439 Vibrio parahaemolyticus R13 Isolate Unclassified
38 2896925746 Vibrio nigripulchritudo SFn27 Isolate Unclassified
39 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
40 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
41 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
42 8022096067 Vibrio sp. SALL6 Isolate Unclassified
43 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
44 8051461712 Vibrio vulnificus Vv002 Isolate
45 8060845732 Vibrio vulnificus Vv006 Isolate
46 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
47 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
48 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
49 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
50 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
51 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
52 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
53 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
54 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
55 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
56 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
57 2515154034 Frischella perrara PEB0191 Isolate Apidae
58 2548876789 Xanthomonas sacchari NCPPB 4393 Isolate
59 2630968947 Frischella perrara PEB0191 Isolate Apidae
60 2648501820 Vibrio nigripulchritudo BLFn1 Isolate Unclassified
61 2667527830 Vibrio parahaemolyticus ISF-29-3 Isolate Unclassified
62 2700989396 Vibrio parahaemolyticus ISF-77-01 Isolate Unclassified
63 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
64 2785510762 Vibrio parahaemolyticus VP14 Isolate Unclassified
65 2868506828 Gilliamella apicola App4-10 Isolate Apidae
66 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
67 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
68 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
69 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
70 8100461708 Delftia sp. S65 Isolate Curculionidae
71 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
72 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
73 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
74 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
75 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
76 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
77 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
78 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
79 2627854002 Vibrio nigripulchritudo ENn2 Isolate Unclassified
80 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
81 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
82 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
83 2850895757 Vibrio campbellii 170502 Isolate Unclassified
84 2860776474 Vibrio parahaemolyticus R14 Isolate Unclassified
85 2872471378 Vibrio owensii V180403 Isolate Unclassified
86 2873636219 Gilliamella apicola App2-1 Isolate Apidae
87 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
88 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
89 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
90 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
91 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
92 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
93 8022087107 Vibrio sp. OULL4 Isolate Unclassified
94 8022439116 Vibrio sp. ArtGut-C1 Isolate Artemiidae
95 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
96 3300000459 Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-C04 Metagenome Apidae
97 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
98 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
99 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
100 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
101 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
102 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
103 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
104 2554235022 Vibrio parahaemolyticus v110 Isolate
105 2648501158 Vibrio hepatarius DSM 19134 Isolate Unclassified
106 2663763317 Vibrio parahaemolyticus ISF-94-1 Isolate Unclassified
107 2912570088 Vibrio parahaemolyticus CHN25 Isolate
108 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
109 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
110 8051551332 Vibrio vulnificus Vv003 Isolate
111 8100449422 Delftia sp. S66 Isolate Curculionidae
112 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
113 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
114 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
115 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
116 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
117 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
118 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
119 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
120 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
121 2609459958 Vibrio nigripulchritudo Wn13 Isolate Unclassified
122 2630968716 Vibrio nigripulchritudo AM115 Isolate Unclassified
123 2636415542 Vibrio nigripulchritudo SFn135 Isolate Unclassified
124 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
125 2684622921 Frischella perrara Fp_167 Isolate Unclassified
126 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
127 2833532623 Frischella perrara ESL0167 Isolate Apidae
128 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
129 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
130 2864764899 Aeromonas fluvialis S00019 Isolate Elmidae
131 2864768727 Aeromonas veronii S00020 Isolate Elmidae
132 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
133 2880115952 Vibrio parahaemolyticus PB1937 Isolate Unclassified
134 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
135 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
136 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
137 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
138 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
139 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
140 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
141 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
142 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
143 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
144 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
145 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
146 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
147 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
148 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
149 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
150 2617270844 Dyella sp. HyOG Isolate Cixiidae
151 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
152 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
153 2864751016 Pseudomonas oryzihabitans S00005 Isolate Elmidae
154 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
155 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
156 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
157 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
158 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
159 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
160 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
161 8116627632 Vibrio penaeicida NBRC 15640 Isolate Unclassified
162 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
163 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
164 2551306507 Vibrio parahaemolyticus PCV08-7 Isolate Unclassified
165 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
166 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
167 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
168 2791355473 Vibrio barjaei 3062 Isolate Unclassified
169 2838140227 Dyella sp. OAE510 Isolate Unclassified
170 2864796242 Aeromonas hydrophilia S00040 Isolate Elmidae
171 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
172 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
173 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
174 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
175 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
176 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
177 8051534459 Vibrio vulnificus Vv004 Isolate
178 8065340634 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
179 3000861951 Budvicia diplopodorum D9 Isolate
180 3006225627 Vibrio sp. Hep-1b-8 Isolate Unclassified
181 3006242587 Vibrio sp. RE86 Isolate Unclassified
182 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
183 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
184 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
185 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
186 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_021724 3300042612 Bacteria 82521
2 Ga0466705_053435 3300042612 Bacteria 27619
3 Ga0123356_10037525 3300010049 Bacteria 4520
4 Ga0466710_034181 3300042613 Bacteria 1639
5 Ga0466715_181754 3300042616 Bacteria 79863
6 Ga0466726_083930 3300042619 Bacteria 23331
7 Ga0466713_050606 3300042602 Bacteria 4796
8 Ga0160467_101080 3300012829 Bacteria 14002
9 Ga0160459_100045 3300012831 Bacteria 207196
10 Ga0160444_101243 3300012841 Bacteria 5433
11 Ga0160430_110710 3300012852 Unclassified 1571
12 Ga0466657_012670 3300042582 Bacteria 6501
13 Ga0466657_368674 3300042582 Bacteria 1366
14 gam1t_NODE_689636_length=159105_GC=32_4_Contigs=24 2189573031 Bacteria 159335
15 HBC_ctgsDRAFT_1000509 3300000333 Bacteria 8737
16 Ga0102736_1001481 3300007052 Bacteria 4108
17 Ga0102734_1000038 3300007129 Bacteria 44043
18 Ga0102738_1000771 3300007141 Bacteria 5119
19 Ga0466733_121053 3300042659 Bacteria 7865
20 Ga0160470_100042 3300012813 Bacteria 189457
21 Ga0466735_053348 3300042624 Bacteria 17300
22 Ga0466710_110693 3300042613 Bacteria 3212
23 Ga0466711_275755 3300042615 Bacteria 30959
24 Ga0466707_079738 3300042601 Bacteria 89147
25 Ga0466713_059751 3300042602 Bacteria 5524
26 Ga0160443_100192 3300012848 Bacteria 80735
27 Ga0160447_101145 3300012849 Bacteria 10621
28 Ga0160448_100140 3300012854 Bacteria 34694
29 Ga0160448_100233 3300012854 Bacteria 22602
30 Ga0160457_1000037 3300012858 Bacteria 225688
31 Ga0103263_100027 3300007042 Bacteria 39471
32 Ga0466732_220026 3300042656 Bacteria 2532
33 Ga0466733_057310 3300042659 Bacteria 34943
34 Ga0466730_005475 3300042625 Bacteria 83148
35 Ga0466710_155550 3300042613 Bacteria 3811
36 Ga0466701_091235 3300042598 Unclassified 45122
37 Ga0466713_051068 3300042602 Bacteria 7957
38 Ga0160468_100404 3300012819 Unclassified 18457
39 Ga0160433_100171 3300012846 Bacteria 54254
40 Ga0160443_103971 3300012848 Bacteria 2373
41 Ga0160436_1000414 3300012861 Bacteria 17368
42 Ga0466657_387694 3300042582 Bacteria 6675
43 SWWA_contig06580__length_4136___numreads_64 2100351016 Unclassified 4136
44 CVPL010W_10000762 3300002931 Bacteria 59721
45 Ga0074278_110888 3300005721 Bacteria 159335
46 Ga0102734_1003806 3300007129 Bacteria 5798
47 Ga0103260_1000043 3300007139 Bacteria 38512
48 Ga0103264_1072327 3300007188 Bacteria 1489
49 Ga0123357_10000144 3300009784 Bacteria 62807
50 Ga0466730_006615 3300042625 Bacteria 4959
51 Ga0466730_046718 3300042625 Bacteria 68019
52 Ga0466718_093490 3300042617 Bacteria 1968
53 Ga0466701_068336 3300042598 Bacteria 3437
54 Ga0466722_095049 3300042609 Bacteria 42286
55 Ga0160441_100091 3300012825 Bacteria 110104
56 Ga0160435_1000213 3300012857 Bacteria 28299
57 Ga0160457_1000055 3300012858 Bacteria 180671
58 Ga0157631_137351 3300013007 Bacteria 1144
59 SWWA_contig17289__length_2920___numreads_34 2100351016 Bacteria 2920
60 HBC_ctgsDRAFT_1000819 3300000333 Unclassified 6867
61 Ga0103266_1006769 3300007067 Bacteria 1430
62 Ga0102735_1000757 3300007080 Bacteria 7276
63 Ga0102735_1001751 3300007080 Unclassified 3558
64 Ga0102740_1003621 3300007140 Bacteria 3259
65 Ga0127656_100080 3300009453 Bacteria 57992
66 Ga0123356_10082051 3300010049 Unclassified 3052
67 Ga0123353_10130629 3300010167 Bacteria 4031
68 Ga0466734_108061 3300042623 Bacteria 6528
69 Ga0466725_063059 3300042654 Bacteria 42120
70 Ga0466710_266898 3300042613 Bacteria 30554
71 Ga0316159_10001 3300030930 Bacteria 1642808
72 SWWA_contig31660__length_24037___numreads_1280 2100351016 Bacteria 24037
73 Ga0063521_1000254 3300003973 Bacteria 35495
74 Ga0068305_10245905 3300005083 Bacteria 2311
75 Ga0103261_1000024 3300007083 Bacteria 66582
76 Ga0103261_1000362 3300007083 Bacteria 9870
77 Ga0104042_1004536 3300007130 Bacteria 2788
78 Ga0103260_1003161 3300007139 Bacteria 2690
79 Ga0102738_1002807 3300007141 Bacteria 2580
80 Ga0104040_1001474 3300007149 Bacteria 2442
81 Ga0103264_1000010 3300007188 Bacteria 126108
82 Ga0123353_10203128 3300010167 Bacteria 3115
83 Ga0466730_065044 3300042625 Bacteria 1177
84 Ga0466707_026244 3300042601 Bacteria 4991
85 Ga0466719_467287 3300042606 Bacteria 5727
86 Ga0160440_100002 3300012815 Bacteria 1234951
87 Ga0160469_100019 3300012824 Bacteria 336789
88 Ga0160436_1000422 3300012861 Bacteria 17061
89 Ga0466701_004861 3300042598 Bacteria 162026
90 Ga0102733_102278 3300006995 Bacteria 1220
91 Ga0102736_1000021 3300007052 Bacteria 92408
92 Ga0102739_1000147 3300007095 Bacteria 19720
93 Ga0466733_170684 3300042659 Bacteria 24962
94 Ga0466735_229826 3300042624 Unclassified 3518
95 Ga0466724_02429 3300042649 Bacteria 9312
96 Ga0466710_111680 3300042613 Bacteria 2733
97 Ga0466723_092998 3300042618 Bacteria 7358
98 Ga0466701_069596 3300042598 Bacteria 1069
99 Ga0466713_038453 3300042602 Bacteria 47379
100 Ga0466717_015615 3300042604 Bacteria 5891
101 Ga0160440_101523 3300012815 Bacteria 2953
102 Ga0160436_1000039 3300012861 Bacteria 73083
103 Ga0316159_12960 3300030930 Bacteria 2493
104 Ga0466657_338988 3300042582 Bacteria 1587
105 DPO_contig00939 2032320009 Bacteria 94479
106 SCG598C04_11372 3300000459 Unclassified 29013
107 Ga0102738_1000128 3300007141 Bacteria 21906
108 Ga0102737_1000112 3300007142 Bacteria 25685
109 Ga0103268_1001921 3300007192 Bacteria 4838
110 Ga0123353_10486923 3300010167 Bacteria 1802
111 Ga0466725_177809 3300042654 Bacteria 7689
112 Ga0466722_241144 3300042609 Bacteria 18394
113 Ga0160452_100101 3300012834 Bacteria 112536
114 Ga0160434_101100 3300012850 Bacteria 5394
115 Ga0466696_213027 3300042596 Bacteria 2199
116 DPOL_contig09368 2035918003 Bacteria 1930
117 2227516023 2225789004 Bacteria 3444
118 Ga0068305_10097494 3300005083 Bacteria 4913
119 Ga0102740_1000011 3300007140 Bacteria 149332
120 Ga0102740_1003819 3300007140 Bacteria 3118
121 Ga0102737_1003389 3300007142 Unclassified 4446
122 Ga0103268_1005308 3300007192 Bacteria 2612
123 Ga0105524_104499 3300007733 Bacteria 2344

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02348 CTP_transf_3 Cytidylyltransferase 38 254 0.96
PF12804 NTP_transf_3 MobA-like NTP transferase domain 52 160 0.85

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.