Protein Family IF08683
Metagenome
101
Members
44
Samples
101
Scaffolds
298.33
Avg Length
Representative Sequence
- ID
- 3300042623|Ga0466734_105606|Ga0466734_105606_180_1151
- Length
- 323 aa
- Sequence
- MENRNKFEGVNSIKFNKYFQSDNDCYRYLSEIKWGSDDPYLCKRCSHTKYGRVKKPYSRRCAKCNYDESPTGGTMFDKLKFSLLIAFHTVIEPACTEPMSKCRNIVFKISTKEEGMSSLELSEEFEIRQMTVWQFKWKIQQAMSSSKCFPLTGEVHIDEFLTGEYEEGKKGRSLDSKKKQVVVALEILGDDGVGRAYAQVIENASAKEFKPFFNNYISKEAKAITDVWKGYLPLKKDYPNLKQIPSNKGKNFKQLHIHIMNIQGWLRGIHHHCTKERLQGYLDEYHFRYNRRNNMGTIFDMTIRRMVINKPVRLKYSKLNTAN
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
63.6%
Kalotermitidae
13.6%
Termopsidae
9.1%
Rhinotermitidae
4.5%
Passalidae
4.5%
Unclassified
2.3%
Hodotermitidae
2.3%
Taxonomy
Archaea
0
Bacteria
89
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 10 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 17 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 28 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 37 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 38 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 39 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_121085 | 3300042611 | Unclassified | 1186 |
| 2 | Ga0123356_10072570 | 3300010049 | Bacteria | 3234 |
| 3 | Ga0123356_10184989 | 3300010049 | Bacteria | 2109 |
| 4 | 2227091647 | 2225789004 | Unclassified | 1832 |
| 5 | JGI24698J34947_10136185 | 3300002449 | Bacteria | 1042 |
| 6 | JGI24702J35022_10131323 | 3300002462 | Bacteria | 1391 |
| 7 | Ga0466656_088543 | 3300042550 | Bacteria | 1635 |
| 8 | Ga0466731_261720 | 3300042622 | Bacteria | 1380 |
| 9 | Ga0466702_389826 | 3300042635 | Bacteria | 1745 |
| 10 | Ga0466703_343188 | 3300042636 | Bacteria | 6722 |
| 11 | Ga0466710_250495 | 3300042613 | Bacteria | 1408 |
| 12 | Ga0466718_084756 | 3300042617 | Bacteria | 2108 |
| 13 | Ga0466707_253152 | 3300042601 | Bacteria | 2673 |
| 14 | Ga0123354_10002666 | 3300010882 | Bacteria | 23880 |
| 15 | Ga0072940_1141419 | 3300005200 | Bacteria | 1818 |
| 16 | Ga0415639_012043 | 3300038395 | Bacteria | 1025 |
| 17 | Ga0466656_360978 | 3300042550 | Bacteria | 1151 |
| 18 | Ga0466657_078612 | 3300042582 | Bacteria | 1541 |
| 19 | Ga0466731_338744 | 3300042622 | Bacteria | 2355 |
| 20 | Ga0466734_112985 | 3300042623 | Bacteria | 1535 |
| 21 | Ga0466734_161457 | 3300042623 | Unclassified | 1535 |
| 22 | Ga0466735_235994 | 3300042624 | Bacteria | 1137 |
| 23 | Ga0466727_261492 | 3300042655 | Bacteria | 3467 |
| 24 | Ga0466721_061107 | 3300042608 | Bacteria | 1357 |
| 25 | Ga0466722_104901 | 3300042609 | Bacteria | 1420 |
| 26 | Ga0123355_10837130 | 3300009826 | Bacteria | 1016 |
| 27 | Ga0123354_10423205 | 3300010882 | Bacteria | 1104 |
| 28 | Ga0466656_058851 | 3300042550 | Bacteria | 2666 |
| 29 | Ga0466696_137422 | 3300042596 | Bacteria | 27896 |
| 30 | Ga0466729_239421 | 3300042621 | Bacteria | 2479 |
| 31 | Ga0466731_077909 | 3300042622 | Unclassified | 1247 |
| 32 | Ga0466731_148511 | 3300042622 | Bacteria | 1850 |
| 33 | Ga0466731_283746 | 3300042622 | Bacteria | 1592 |
| 34 | Ga0466734_052101 | 3300042623 | Unclassified | 1431 |
| 35 | Ga0466704_448716 | 3300042643 | Bacteria | 23460 |
| 36 | Ga0466725_206553 | 3300042654 | Bacteria | 1103 |
| 37 | Ga0466717_161164 | 3300042604 | Unclassified | 1209 |
| 38 | Ga0466717_274190 | 3300042604 | Bacteria | 1183 |
| 39 | Ga0466698_254579 | 3300042610 | Bacteria | 1928 |
| 40 | Ga0466697_108599 | 3300042611 | Bacteria | 1291 |
| 41 | Ga0466733_156347 | 3300042659 | Bacteria | 1440 |
| 42 | Ga0466733_219159 | 3300042659 | Bacteria | 1578 |
| 43 | Ga0123353_10371732 | 3300010167 | Bacteria | 2143 |
| 44 | Ga0123353_10898137 | 3300010167 | Bacteria | 1207 |
| 45 | Ga0123354_10375958 | 3300010882 | Bacteria | 1233 |
| 46 | Ga0123354_10376573 | 3300010882 | Unclassified | 1231 |
| 47 | Ga0068302_10058686 | 3300005071 | Bacteria | 1531 |
| 48 | Ga0466656_185381 | 3300042550 | Bacteria | 2093 |
| 49 | Ga0466731_099064 | 3300042622 | Bacteria | 1116 |
| 50 | Ga0466735_218229 | 3300042624 | Bacteria | 3531 |
| 51 | Ga0466725_183404 | 3300042654 | Bacteria | 1299 |
| 52 | Ga0466725_208113 | 3300042654 | Bacteria | 1245 |
| 53 | Ga0466715_630973 | 3300042616 | Bacteria | 1722 |
| 54 | Ga0466701_029081 | 3300042598 | Bacteria | 2559 |
| 55 | Ga0466697_245706 | 3300042611 | Bacteria | 1757 |
| 56 | Ga0123356_10787395 | 3300010049 | Bacteria | 1122 |
| 57 | 2227464262 | 2225789004 | Bacteria | 986 |
| 58 | JGI24703J35330_11477057 | 3300002501 | Bacteria | 1075 |
| 59 | JGI24705J35276_12090674 | 3300002504 | Bacteria | 994 |
| 60 | Ga0466656_310740 | 3300042550 | Bacteria | 1534 |
| 61 | Ga0466699_381740 | 3300042597 | Bacteria | 1177 |
| 62 | Ga0466731_263612 | 3300042622 | Bacteria | 1339 |
| 63 | Ga0466734_157853 | 3300042623 | Bacteria | 2745 |
| 64 | Ga0466726_294642 | 3300042619 | Bacteria | 1468 |
| 65 | Ga0466701_065912 | 3300042598 | Bacteria | 1197 |
| 66 | Ga0466717_104763 | 3300042604 | Bacteria | 2480 |
| 67 | IMNBL1DRAFT_c0027498 | 3300000062 | Bacteria | 2137 |
| 68 | Ga0466656_206985 | 3300042550 | Bacteria | 1539 |
| 69 | Ga0466731_383161 | 3300042622 | Bacteria | 1366 |
| 70 | Ga0466703_045718 | 3300042636 | Bacteria | 1393 |
| 71 | Ga0466703_219094 | 3300042636 | Bacteria | 2367 |
| 72 | Ga0466706_162872 | 3300042599 | Bacteria | 1988 |
| 73 | Ga0466707_026565 | 3300042601 | Bacteria | 22320 |
| 74 | Ga0466717_170787 | 3300042604 | Bacteria | 1373 |
| 75 | Ga0466697_161917 | 3300042611 | Unclassified | 1083 |
| 76 | JGI24702J35022_10036112 | 3300002462 | Unclassified | 2641 |
| 77 | JGI24702J35022_10053725 | 3300002462 | Bacteria | 2149 |
| 78 | Ga0466656_115634 | 3300042550 | Bacteria | 1188 |
| 79 | Ga0466656_129809 | 3300042550 | Bacteria | 3017 |
| 80 | Ga0466734_105606 | 3300042623 | Unclassified | 1219 |
| 81 | Ga0466703_080940 | 3300042636 | Unclassified | 1505 |
| 82 | Ga0466710_330840 | 3300042613 | Bacteria | 1507 |
| 83 | Ga0466717_006644 | 3300042604 | Bacteria | 1124 |
| 84 | Ga0466717_115349 | 3300042604 | Bacteria | 1069 |
| 85 | Ga0466719_057451 | 3300042606 | Bacteria | 1274 |
| 86 | Ga0466698_004264 | 3300042610 | Bacteria | 1848 |
| 87 | Ga0466697_175104 | 3300042611 | Bacteria | 1159 |
| 88 | Ga0466697_233923 | 3300042611 | Bacteria | 1231 |
| 89 | Ga0466732_104764 | 3300042656 | Bacteria | 1994 |
| 90 | Ga0466732_118938 | 3300042656 | Bacteria | 1061 |
| 91 | Ga0123356_10326209 | 3300010049 | Bacteria | 1650 |
| 92 | Ga0123353_10448943 | 3300010167 | Bacteria | 1899 |
| 93 | JGI24696J40584_12870095 | 3300002834 | Bacteria | 1042 |
| 94 | Ga0466656_197736 | 3300042550 | Unclassified | 1022 |
| 95 | Ga0466731_063878 | 3300042622 | Bacteria | 1076 |
| 96 | Ga0466734_172457 | 3300042623 | Bacteria | 2155 |
| 97 | Ga0466724_46058 | 3300042649 | Bacteria | 1078 |
| 98 | Ga0466725_459541 | 3300042654 | Bacteria | 1560 |
| 99 | Ga0466705_445348 | 3300042612 | Bacteria | 2598 |
| 100 | Ga0466721_206021 | 3300042608 | Bacteria | 1353 |
| 101 | Ga0466722_037104 | 3300042609 | Bacteria | 3285 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042550 | Ga0466656_360978 | Ga0466656_360978_151_918 | 247 |
| 2 | 3300042611 | Ga0466697_161917 | Ga0466697_161917_65_811 | 248 |
| 3 | 3300042597 | Ga0466699_381740 | Ga0466699_381740_268_1050 | 260 |
| 4 | 3300042606 | Ga0466719_057451 | Ga0466719_057451_176_961 | 261 |
| 5 | 2225789004 | 2227091647 | 2227470865 | 273 |
| 6 | 3300042604 | Ga0466717_274190 | Ga0466717_274190_67_960 | 278 |
| 7 | 3300042623 | Ga0466734_172457 | Ga0466734_172457_118_1035 | 284 |
| 8 | 3300042550 | Ga0466656_197736 | Ga0466656_197736_43_945 | 286 |
| 9 | 3300042604 | Ga0466717_115349 | Ga0466717_115349_111_1028 | 288 |
| 10 | 3300042598 | Ga0466701_065912 | Ga0466701_065912_268_1170 | 289 |
| 11 | 3300042610 | Ga0466698_004264 | Ga0466698_004264_478_1380 | 289 |
| 12 | 3300042622 | Ga0466731_338744 | Ga0466731_338744_1211_2107 | 290 |
| 13 | 3300042623 | Ga0466734_157853 | Ga0466734_157853_1643_2515 | 290 |
| 14 | 3300010167 | Ga0123353_10448943 | Ga0123353_104489431 | 291 |
| 15 | 3300042609 | Ga0466722_037104 | Ga0466722_037104_2020_2946 | 291 |
| 16 | 3300002462 | JGI24702J35022_10053725 | JGI24702J35022_100537252 | 292 |
| 17 | 3300042598 | Ga0466701_029081 | Ga0466701_029081_1506_2408 | 292 |
| 18 | 3300042622 | Ga0466731_383161 | Ga0466731_383161_355_1257 | 292 |
| 19 | 3300010049 | Ga0123356_10326209 | Ga0123356_103262092 | 293 |
| 20 | 3300010049 | Ga0123356_10787395 | Ga0123356_107873951 | 293 |
| 21 | 3300042622 | Ga0466731_077909 | Ga0466731_077909_205_1128 | 293 |
| 22 | 3300042622 | Ga0466731_261720 | Ga0466731_261720_220_1125 | 293 |
| 23 | 3300042622 | Ga0466731_263612 | Ga0466731_263612_164_1069 | 293 |
| 24 | 3300010049 | Ga0123356_10184989 | Ga0123356_101849892 | 294 |
| 25 | 3300010882 | Ga0123354_10002666 | Ga0123354_100026665 | 294 |
| 26 | 3300042635 | Ga0466702_389826 | Ga0466702_389826_596_1513 | 294 |
| 27 | 3300042654 | Ga0466725_206553 | Ga0466725_206553_199_1083 | 294 |
| 28 | 3300010049 | Ga0123356_10072570 | Ga0123356_100725702 | 295 |
| 29 | 3300042601 | Ga0466707_026565 | Ga0466707_026565_1804_2691 | 295 |
| 30 | 3300042619 | Ga0466726_294642 | Ga0466726_294642_295_1218 | 295 |
| 31 | 3300042623 | Ga0466734_112985 | Ga0466734_112985_503_1390 | 295 |
| 32 | 3300042550 | Ga0466656_088543 | Ga0466656_088543_382_1272 | 296 |
| 33 | 3300042636 | Ga0466703_045718 | Ga0466703_045718_246_1163 | 296 |
| 34 | 2225789004 | 2227464262 | 2227900881 | 297 |
| 35 | 3300042608 | Ga0466721_206021 | Ga0466721_206021_114_1007 | 297 |
| 36 | 3300042643 | Ga0466704_448716 | Ga0466704_448716_19590_20483 | 297 |
| 37 | 3300042550 | Ga0466656_058851 | Ga0466656_058851_660_1583 | 298 |
| 38 | 3300042612 | Ga0466705_445348 | Ga0466705_445348_1650_2546 | 298 |
| 39 | 3300042621 | Ga0466729_239421 | Ga0466729_239421_337_1233 | 298 |
| 40 | 3300010882 | Ga0123354_10375958 | Ga0123354_103759581 | 299 |
| 41 | 3300042599 | Ga0466706_162872 | Ga0466706_162872_918_1817 | 299 |
| 42 | 3300042613 | Ga0466710_330840 | Ga0466710_330840_507_1406 | 299 |
| 43 | 3300042659 | Ga0466733_156347 | Ga0466733_156347_280_1179 | 299 |
| 44 | 3300042604 | Ga0466717_161164 | Ga0466717_161164_136_1038 | 300 |
| 45 | 3300042609 | Ga0466722_104901 | Ga0466722_104901_464_1366 | 300 |
| 46 | 3300042610 | Ga0466698_254579 | Ga0466698_254579_228_1145 | 300 |
| 47 | 3300042613 | Ga0466710_250495 | Ga0466710_250495_184_1086 | 300 |
| 48 | 3300042622 | Ga0466731_099064 | Ga0466731_099064_114_1016 | 300 |
| 49 | 3300042656 | Ga0466732_104764 | Ga0466732_104764_880_1782 | 300 |
| 50 | 3300042659 | Ga0466733_219159 | Ga0466733_219159_207_1109 | 300 |
| 51 | 3300002501 | JGI24703J35330_11477057 | JGI24703J35330_114770571 | 301 |
| 52 | 3300002504 | JGI24705J35276_12090674 | JGI24705J35276_120906741 | 301 |
| 53 | 3300009826 | Ga0123355_10837130 | Ga0123355_108371301 | 301 |
| 54 | 3300010167 | Ga0123353_10371732 | Ga0123353_103717322 | 301 |
| 55 | 3300010882 | Ga0123354_10423205 | Ga0123354_104232051 | 301 |
| 56 | 3300042582 | Ga0466657_078612 | Ga0466657_078612_224_1129 | 301 |
| 57 | 3300042611 | Ga0466697_175104 | Ga0466697_175104_122_1027 | 301 |
| 58 | 3300042654 | Ga0466725_459541 | Ga0466725_459541_395_1300 | 301 |
| 59 | 3300042604 | Ga0466717_006644 | Ga0466717_006644_95_1003 | 302 |
| 60 | 3300000062 | IMNBL1DRAFT_c0027498 | IMNBL1DRAFT_00274983 | 303 |
| 61 | 3300038395 | Ga0415639_012043 | Ga0415639_012043_98_1012 | 304 |
| 62 | 3300042596 | Ga0466696_137422 | Ga0466696_137422_425_1339 | 304 |
| 63 | 3300042616 | Ga0466715_630973 | Ga0466715_630973_453_1367 | 304 |
| 64 | 3300042617 | Ga0466718_084756 | Ga0466718_084756_566_1480 | 304 |
| 65 | 3300002834 | JGI24696J40584_12870095 | JGI24696J40584_128700951 | 305 |
| 66 | 3300010882 | Ga0123354_10376573 | Ga0123354_103765731 | 305 |
| 67 | 3300042550 | Ga0466656_185381 | Ga0466656_185381_625_1542 | 305 |
| 68 | 3300042611 | Ga0466697_108599 | Ga0466697_108599_174_1091 | 305 |
| 69 | 3300042611 | Ga0466697_245706 | Ga0466697_245706_171_1088 | 305 |
| 70 | 3300042623 | Ga0466734_052101 | Ga0466734_052101_16_933 | 305 |
| 71 | 3300042623 | Ga0466734_161457 | Ga0466734_161457_404_1321 | 305 |
| 72 | 3300042636 | Ga0466703_080940 | Ga0466703_080940_387_1304 | 305 |
| 73 | 3300042655 | Ga0466727_261492 | Ga0466727_261492_15_932 | 305 |
| 74 | 3300002449 | JGI24698J34947_10136185 | JGI24698J34947_101361851 | 306 |
| 75 | 3300005200 | Ga0072940_1141419 | Ga0072940_11414191 | 306 |
| 76 | 3300010167 | Ga0123353_10898137 | Ga0123353_108981372 | 306 |
| 77 | 3300042611 | Ga0466697_121085 | Ga0466697_121085_173_1093 | 306 |
| 78 | 3300042622 | Ga0466731_148511 | Ga0466731_148511_780_1700 | 306 |
| 79 | 3300042622 | Ga0466731_283746 | Ga0466731_283746_211_1131 | 306 |
| 80 | 3300042624 | Ga0466735_235994 | Ga0466735_235994_139_1059 | 306 |
| 81 | 3300042601 | Ga0466707_253152 | Ga0466707_253152_416_1339 | 307 |
| 82 | 3300042611 | Ga0466697_233923 | Ga0466697_233923_250_1173 | 307 |
| 83 | 3300042636 | Ga0466703_219094 | Ga0466703_219094_23_946 | 307 |
| 84 | 3300042649 | Ga0466724_46058 | Ga0466724_46058_106_1029 | 307 |
| 85 | 3300042656 | Ga0466732_118938 | Ga0466732_118938_43_966 | 307 |
| 86 | 3300005071 | Ga0068302_10058686 | Ga0068302_100586862 | 308 |
| 87 | 3300042550 | Ga0466656_115634 | Ga0466656_115634_121_1047 | 308 |
| 88 | 3300042550 | Ga0466656_129809 | Ga0466656_129809_1984_2910 | 308 |
| 89 | 3300042550 | Ga0466656_206985 | Ga0466656_206985_229_1155 | 308 |
| 90 | 3300042550 | Ga0466656_310740 | Ga0466656_310740_423_1349 | 308 |
| 91 | 3300042604 | Ga0466717_104763 | Ga0466717_104763_1496_2422 | 308 |
| 92 | 3300042604 | Ga0466717_170787 | Ga0466717_170787_141_1067 | 308 |
| 93 | 3300042608 | Ga0466721_061107 | Ga0466721_061107_189_1115 | 308 |
| 94 | 3300042622 | Ga0466731_063878 | Ga0466731_063878_80_1006 | 308 |
| 95 | 3300042624 | Ga0466735_218229 | Ga0466735_218229_2592_3518 | 308 |
| 96 | 3300042636 | Ga0466703_343188 | Ga0466703_343188_5398_6324 | 308 |
| 97 | 3300042654 | Ga0466725_183404 | Ga0466725_183404_109_1035 | 308 |
| 98 | 3300042654 | Ga0466725_208113 | Ga0466725_208113_132_1058 | 308 |
| 99 | 3300002462 | JGI24702J35022_10036112 | JGI24702J35022_100361122 | 309 |
| 100 | 3300002462 | JGI24702J35022_10131323 | JGI24702J35022_101313232 | 309 |
| 101 | 3300042623 | Ga0466734_105606 | Ga0466734_105606_180_1151 | 323 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.