Protein Family IF08673
Metagenome
Isolate
198
Members
60
Samples
178
Scaffolds
269.66
Avg Length
Representative Sequence
- ID
- 3300042623|Ga0466734_083287|Ga0466734_083287_213_1127
- Length
- 304 aa
- Sequence
- LTSKKVYKYTIFIYNFSKIILTFEVQMKQNIEINNKMSILKNRSALERQIAEVAEVAGYLWQKGWAERNGGNITVNVTDEIDDEIRNLPPISNIVPIGRMLPHLKGCCFYCKGTNLRMRDLARRPMENGSVIRMLDDCSSYVIIADNPVKPTSELASHLSMHNYLKGKGSNYKAVLHTHPIDLVAMTHNPAFLKKDVLSHLLWSMIPETRAFCPRGLGIVPYALPGSFELADATIRQLDEYDVVMWEKHGVCAVGPTIMEAFDMIDTLSKSAQIYLTGKSMGFEPEGMTVMQMEEMKTAFNLPK
Sample Types
Isolate
10.1%
Metagenome
89.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
24.1%
Termitidae
20.7%
Unclassified
15.5%
Blattidae
12.1%
Rhinotermitidae
10.3%
Termopsidae
6.9%
Hydrophilidae
3.4%
Passalidae
3.4%
Hodotermitidae
1.7%
Curculionidae
1.7%
Taxonomy
Archaea
0
Bacteria
190
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 12 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 13 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 25 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 26 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 29 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 40 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 41 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 42 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 43 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 44 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 45 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 46 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 47 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 48 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 49 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 50 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 51 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 52 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 53 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 54 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 55 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 56 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0265387_1002288 | 3300024582 | Bacteria | 2713 |
| 2 | Ga0466690_005994 | 3300042590 | Bacteria | 4206 |
| 3 | Ga0466690_210132 | 3300042590 | Bacteria | 5685 |
| 4 | Ga0466696_144630 | 3300042596 | Bacteria | 1342 |
| 5 | Ga0466696_197607 | 3300042596 | Bacteria | 1426 |
| 6 | Ga0466703_246639 | 3300042636 | Bacteria | 5035 |
| 7 | Ga0466703_313365 | 3300042636 | Bacteria | 5744 |
| 8 | Ga0123356_10021132 | 3300010049 | Bacteria | 6152 |
| 9 | Ga0123354_10038965 | 3300010882 | Bacteria | 7371 |
| 10 | Ga0466711_103583 | 3300042615 | Bacteria | 8624 |
| 11 | Ga0466715_004239 | 3300042616 | Bacteria | 11776 |
| 12 | Ga0466723_218142 | 3300042618 | Bacteria | 21144 |
| 13 | Ga0466707_030501 | 3300042601 | Bacteria | 17725 |
| 14 | Ga0466707_211267 | 3300042601 | Bacteria | 5562 |
| 15 | Ga0466713_026234 | 3300042602 | Bacteria | 17662 |
| 16 | Ga0466713_113316 | 3300042602 | Bacteria | 40093 |
| 17 | Ga0466716_105808 | 3300042605 | Bacteria | 5268 |
| 18 | Ga0466716_167878 | 3300042605 | Bacteria | 9694 |
| 19 | Ga0466719_435582 | 3300042606 | Bacteria | 1324 |
| 20 | Ga0466719_528951 | 3300042606 | Bacteria | 1078 |
| 21 | Ga0466697_137355 | 3300042611 | Bacteria | 1493 |
| 22 | Ga0466697_238801 | 3300042611 | Bacteria | 1021 |
| 23 | Ga0466705_303651 | 3300042612 | Bacteria | 5927 |
| 24 | Ga0466691_106300 | 3300042593 | Bacteria | 20437 |
| 25 | Ga0466691_126555 | 3300042593 | Bacteria | 10907 |
| 26 | Ga0466696_119811 | 3300042596 | Unclassified | 4357 |
| 27 | Ga0466703_331263 | 3300042636 | Bacteria | 18136 |
| 28 | Ga0466703_381419 | 3300042636 | Bacteria | 3258 |
| 29 | Ga0466704_176305 | 3300042643 | Bacteria | 7068 |
| 30 | Ga0466708_015328 | 3300042652 | Bacteria | 2123 |
| 31 | Ga0466708_135706 | 3300042652 | Unclassified | 9656 |
| 32 | Ga0466708_305798 | 3300042652 | Bacteria | 30289 |
| 33 | Ga0123357_10321973 | 3300009784 | Bacteria | 1526 |
| 34 | Ga0123356_10311818 | 3300010049 | Bacteria | 1683 |
| 35 | Ga0123354_10107302 | 3300010882 | Bacteria | 3720 |
| 36 | Ga0123354_10112043 | 3300010882 | Bacteria | 3595 |
| 37 | Ga0123354_10169711 | 3300010882 | Bacteria | 2546 |
| 38 | 2227475480 | 2225789004 | Bacteria | 4664 |
| 39 | Ga0068305_10002024 | 3300005083 | Bacteria | 34246 |
| 40 | Ga0068305_10320943 | 3300005083 | Bacteria | 6317 |
| 41 | Ga0466723_005405 | 3300042618 | Bacteria | 8450 |
| 42 | Ga0466723_287921 | 3300042618 | Bacteria | 3787 |
| 43 | Ga0466728_148535 | 3300042620 | Bacteria | 2523 |
| 44 | Ga0466713_023468 | 3300042602 | Bacteria | 115789 |
| 45 | Ga0466716_040186 | 3300042605 | Bacteria | 2556 |
| 46 | Ga0466716_540318 | 3300042605 | Bacteria | 2538 |
| 47 | Ga0466705_056667 | 3300042612 | Bacteria | 4447 |
| 48 | Ga0466690_153366 | 3300042590 | Unclassified | 14261 |
| 49 | Ga0466690_252597 | 3300042590 | Bacteria | 23645 |
| 50 | Ga0466692_060272 | 3300042591 | Bacteria | 8827 |
| 51 | Ga0466704_011166 | 3300042643 | Bacteria | 1952 |
| 52 | Ga0466704_598343 | 3300042643 | Bacteria | 1151 |
| 53 | Ga0466709_106293 | 3300042648 | Bacteria | 11933 |
| 54 | Ga0123356_10043866 | 3300010049 | Bacteria | 4164 |
| 55 | Ga0123353_10344042 | 3300010167 | Bacteria | 2251 |
| 56 | Ga0123354_10004445 | 3300010882 | Bacteria | 19882 |
| 57 | JGI24699J35502_11133963 | 3300002509 | Bacteria | 21757 |
| 58 | Ga0466711_138683 | 3300042615 | Bacteria | 30731 |
| 59 | Ga0466715_025615 | 3300042616 | Bacteria | 20122 |
| 60 | Ga0466715_332133 | 3300042616 | Bacteria | 83480 |
| 61 | Ga0466728_107051 | 3300042620 | Bacteria | 12575 |
| 62 | Ga0466707_074933 | 3300042601 | Bacteria | 9174 |
| 63 | Ga0466713_096127 | 3300042602 | Bacteria | 27741 |
| 64 | Ga0466713_099716 | 3300042602 | Bacteria | 24500 |
| 65 | Ga0466705_023945 | 3300042612 | Bacteria | 11611 |
| 66 | Ga0466705_104637 | 3300042612 | Unclassified | 4271 |
| 67 | Ga0466690_008579 | 3300042590 | Bacteria | 25173 |
| 68 | Ga0466690_296951 | 3300042590 | Bacteria | 3576 |
| 69 | Ga0466692_072189 | 3300042591 | Bacteria | 11130 |
| 70 | Ga0466692_123090 | 3300042591 | Bacteria | 15817 |
| 71 | Ga0466691_105937 | 3300042593 | Unclassified | 6322 |
| 72 | Ga0466691_127154 | 3300042593 | Bacteria | 2388 |
| 73 | Ga0466696_463796 | 3300042596 | Bacteria | 19807 |
| 74 | Ga0466699_100144 | 3300042597 | Bacteria | 2847 |
| 75 | Ga0466734_083287 | 3300042623 | Bacteria | 1169 |
| 76 | Ga0466735_033980 | 3300042624 | Bacteria | 2048 |
| 77 | Ga0466703_354164 | 3300042636 | Bacteria | 8930 |
| 78 | Ga0466709_013081 | 3300042648 | Bacteria | 23336 |
| 79 | Ga0123354_10013229 | 3300010882 | Bacteria | 12799 |
| 80 | Ga0123354_10152341 | 3300010882 | Bacteria | 2794 |
| 81 | Ga0068302_10248742 | 3300005071 | Bacteria | 1828 |
| 82 | Ga0123357_10003056 | 3300009784 | Bacteria | 18975 |
| 83 | Ga0466715_017045 | 3300042616 | Bacteria | 22826 |
| 84 | Ga0466715_604850 | 3300042616 | Bacteria | 13476 |
| 85 | Ga0466723_139250 | 3300042618 | Bacteria | 7905 |
| 86 | Ga0466728_149220 | 3300042620 | Bacteria | 2698 |
| 87 | Ga0466706_164086 | 3300042599 | Bacteria | 1867 |
| 88 | Ga0466707_413602 | 3300042601 | Bacteria | 12802 |
| 89 | Ga0466707_423074 | 3300042601 | Bacteria | 7574 |
| 90 | Ga0466713_054574 | 3300042602 | Bacteria | 70949 |
| 91 | Ga0466713_097614 | 3300042602 | Bacteria | 86999 |
| 92 | Ga0466719_234875 | 3300042606 | Bacteria | 6439 |
| 93 | Ga0466722_210324 | 3300042609 | Bacteria | 22548 |
| 94 | Ga0466705_007783 | 3300042612 | Bacteria | 12114 |
| 95 | Ga0466691_217731 | 3300042593 | Bacteria | 6229 |
| 96 | Ga0466696_061064 | 3300042596 | Bacteria | 4669 |
| 97 | Ga0466735_220380 | 3300042624 | Bacteria | 10536 |
| 98 | Ga0466703_021875 | 3300042636 | Unclassified | 3539 |
| 99 | Ga0466703_424646 | 3300042636 | Bacteria | 15108 |
| 100 | Ga0466704_075089 | 3300042643 | Bacteria | 4478 |
| 101 | Ga0466704_119635 | 3300042643 | Bacteria | 13895 |
| 102 | Ga0466704_276503 | 3300042643 | Bacteria | 3532 |
| 103 | Ga0466704_445710 | 3300042643 | Bacteria | 5854 |
| 104 | Ga0466708_405805 | 3300042652 | Bacteria | 20783 |
| 105 | Ga0466727_050716 | 3300042655 | Bacteria | 9180 |
| 106 | IMNBL1DRAFT_c0000642 | 3300000062 | Bacteria | 27994 |
| 107 | IMNBL1DRAFT_c0009621 | 3300000062 | Bacteria | 4749 |
| 108 | Ga0063521_1000247 | 3300003973 | Bacteria | 36249 |
| 109 | Ga0466705_412357 | 3300042612 | Bacteria | 6060 |
| 110 | Ga0466726_066769 | 3300042619 | Bacteria | 1309 |
| 111 | Ga0466706_094212 | 3300042599 | Bacteria | 15235 |
| 112 | Ga0466706_244303 | 3300042599 | Bacteria | 41796 |
| 113 | Ga0466700_018200 | 3300042600 | Bacteria | 8348 |
| 114 | Ga0466719_441177 | 3300042606 | Bacteria | 1616 |
| 115 | Ga0466705_101303 | 3300042612 | Bacteria | 9204 |
| 116 | Ga0466705_118786 | 3300042612 | Bacteria | 1591 |
| 117 | Ga0466733_182333 | 3300042659 | Bacteria | 10536 |
| 118 | Ga0466696_465127 | 3300042596 | Bacteria | 1223 |
| 119 | Ga0466729_208291 | 3300042621 | Bacteria | 9574 |
| 120 | Ga0466703_403043 | 3300042636 | Bacteria | 3677 |
| 121 | Ga0466704_204223 | 3300042643 | Bacteria | 16498 |
| 122 | Ga0466704_306402 | 3300042643 | Bacteria | 17351 |
| 123 | Ga0123357_10025745 | 3300009784 | Bacteria | 7941 |
| 124 | Ga0123357_10091789 | 3300009784 | Unclassified | 3953 |
| 125 | Ga0123357_10286799 | 3300009784 | Unclassified | 1689 |
| 126 | JGI24699J35502_11134003 | 3300002509 | Bacteria | 23856 |
| 127 | Ga0466715_028076 | 3300042616 | Bacteria | 14546 |
| 128 | Ga0466723_149208 | 3300042618 | Bacteria | 2684 |
| 129 | Ga0466701_079078 | 3300042598 | Bacteria | 1643 |
| 130 | Ga0466706_133122 | 3300042599 | Bacteria | 38436 |
| 131 | Ga0466707_406051 | 3300042601 | Bacteria | 13352 |
| 132 | Ga0466722_023454 | 3300042609 | Bacteria | 8074 |
| 133 | Ga0466722_043443 | 3300042609 | Bacteria | 10020 |
| 134 | Ga0466722_076972 | 3300042609 | Bacteria | 1781 |
| 135 | Ga0466705_133193 | 3300042612 | Bacteria | 13722 |
| 136 | Ga0466733_132084 | 3300042659 | Bacteria | 1030 |
| 137 | Ga0466691_083530 | 3300042593 | Bacteria | 8078 |
| 138 | Ga0466729_296492 | 3300042621 | Bacteria | 2466 |
| 139 | Ga0466730_041963 | 3300042625 | Bacteria | 1755 |
| 140 | Ga0466703_103520 | 3300042636 | Bacteria | 1366 |
| 141 | Ga0466703_143545 | 3300042636 | Bacteria | 11241 |
| 142 | Ga0466704_576501 | 3300042643 | Bacteria | 6012 |
| 143 | Ga0466709_007054 | 3300042648 | Bacteria | 134641 |
| 144 | Ga0466708_366709 | 3300042652 | Bacteria | 24882 |
| 145 | Ga0466727_042356 | 3300042655 | Bacteria | 1438 |
| 146 | Ga0123357_10265703 | 3300009784 | Bacteria | 1804 |
| 147 | IMNBL1DRAFT_c0015422 | 3300000062 | Bacteria | 3317 |
| 148 | Ga0123357_10002899 | 3300009784 | Bacteria | 19331 |
| 149 | Ga0466715_035008 | 3300042616 | Bacteria | 46054 |
| 150 | Ga0466715_449377 | 3300042616 | Bacteria | 5631 |
| 151 | Ga0466726_164026 | 3300042619 | Bacteria | 16878 |
| 152 | Ga0466706_123667 | 3300042599 | Bacteria | 4742 |
| 153 | Ga0466706_186857 | 3300042599 | Bacteria | 1826 |
| 154 | Ga0466707_012597 | 3300042601 | Bacteria | 16735 |
| 155 | Ga0466713_135579 | 3300042602 | Bacteria | 5064 |
| 156 | Ga0466705_149805 | 3300042612 | Bacteria | 4203 |
| 157 | Ga0466690_354941 | 3300042590 | Bacteria | 44034 |
| 158 | Ga0466692_116396 | 3300042591 | Bacteria | 11933 |
| 159 | Ga0466696_061533 | 3300042596 | Bacteria | 7727 |
| 160 | Ga0466735_168142 | 3300042624 | Bacteria | 1817 |
| 161 | Ga0466703_095271 | 3300042636 | Bacteria | 1901 |
| 162 | Ga0466709_143008 | 3300042648 | Bacteria | 6099 |
| 163 | Ga0466709_146482 | 3300042648 | Bacteria | 25195 |
| 164 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 165 | Ga0466727_095336 | 3300042655 | Bacteria | 1851 |
| 166 | Ga0466727_120774 | 3300042655 | Bacteria | 1053 |
| 167 | Ga0466727_185228 | 3300042655 | Bacteria | 1945 |
| 168 | Ga0466727_196576 | 3300042655 | Bacteria | 91619 |
| 169 | Ga0123357_10327478 | 3300009784 | Bacteria | 1502 |
| 170 | Ga0123354_10024307 | 3300010882 | Bacteria | 9556 |
| 171 | Ga0123354_10150572 | 3300010882 | Bacteria | 2821 |
| 172 | Ga0123357_10000306 | 3300009784 | Bacteria | 46839 |
| 173 | Ga0466711_371523 | 3300042615 | Bacteria | 9030 |
| 174 | Ga0466715_146090 | 3300042616 | Bacteria | 20213 |
| 175 | Ga0466726_050591 | 3300042619 | Bacteria | 1173 |
| 176 | Ga0466728_269130 | 3300042620 | Bacteria | 6356 |
| 177 | Ga0466701_061347 | 3300042598 | Bacteria | 18352 |
| 178 | Ga0466713_004475 | 3300042602 | Bacteria | 5137 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00596 | Aldolase_II | Class II Aldolase and Adducin N-terminal domain | 52 | 276 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.