Protein Family IF08638
Metagenome
Isolate
408
Members
288
Samples
198
Scaffolds
273.3
Avg Length
Representative Sequence
- ID
- 3300042623|Ga0466734_012396|Ga0466734_012396_1484_2467
- Length
- 327 aa
- Sequence
- MTVFVAGGFQVRSPSAAPTQVHKALPGWQRPPEAACQNPRLLSWCRGGARGNCLLKSESFIEIDHVTFGYDERRTILNDLSLNFKRGRVTAVLGGSGCGKTTLLRLIGGVHAANKGRVVFDGEVIDVRDRAQLYRLRRRLGMLFQFGALFTDLSVFDNVAFPLREMSGLPESMIRDLVLMKLNAVGLRGAAGLKISEVSGGMARRVALARAIALDPELIMYDEPFAGLDLISMGVTAKLIRTLNDATGATSLVISHDVPQCMAISDWVVLLAAGGRLVAQGTPAELMASSEPEVRQFVRGEPDGPVKFHYPAPDLAVDFGVAGGGRA
Sample Types
Isolate
51.5%
Metagenome
48.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
28.4%
Apidae
23.8%
Unclassified
14.2%
Termitidae
8.9%
Formicidae
4.6%
Kalotermitidae
4.3%
Elmidae
3.9%
Culicidae
3.5%
Rhinotermitidae
1.4%
Termopsidae
1.1%
Curculionidae
1.1%
Berytidae
0.7%
Hydrophilidae
0.7%
Passalidae
0.7%
Armadillidiidae
0.7%
Largidae
0.7%
Drosophilidae
0.4%
Hodotermitidae
0.4%
Ixodidae
0.4%
Alydidae
0.4%
Taxonomy
Archaea
0
Bacteria
398
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 2 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 3 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 4 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 5 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 6 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 7 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 8 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 9 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 10 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 11 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 12 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 13 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 14 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 15 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 16 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 17 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 18 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 21 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 22 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 23 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 24 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 25 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 26 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 27 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 28 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 29 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 30 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 31 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 32 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 33 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 34 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 37 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 40 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 46 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 47 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 48 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 49 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 50 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 51 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 52 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 53 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 54 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 55 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 56 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 57 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 58 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 59 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 60 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 61 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 62 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 63 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 64 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 65 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 66 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 67 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 68 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 69 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 70 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 71 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 72 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 73 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 74 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 75 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 76 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 77 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 78 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 79 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 80 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 81 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 82 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 83 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 84 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 85 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 86 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 87 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 88 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 89 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 90 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 91 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 92 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 93 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 94 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 95 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 96 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 97 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 98 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 99 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 100 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 101 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 102 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 103 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 104 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 105 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 106 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 107 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 108 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 109 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 110 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 111 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 112 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 113 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 114 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 115 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 116 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 117 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 118 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 119 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 120 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 121 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 122 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 123 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 124 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 125 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 126 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 127 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 128 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 129 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 130 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 131 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 132 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 133 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 134 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 135 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 136 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 137 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 138 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 139 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 140 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 141 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 142 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 143 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 144 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 145 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 146 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 147 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 148 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 149 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 150 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 151 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 152 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 153 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 154 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 155 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 156 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 157 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 158 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 159 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 160 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 161 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 162 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 163 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 164 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 165 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 166 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 167 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 168 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 169 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 170 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 171 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 172 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 173 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 174 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 175 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 176 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 177 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 178 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 179 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 180 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 181 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 182 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 183 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 184 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 185 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 186 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 187 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 188 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 189 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 190 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 191 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 192 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 193 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 194 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 195 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 196 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 197 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 198 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 199 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 200 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 201 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 202 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 203 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 204 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 205 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 206 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 207 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 208 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 209 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 210 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 211 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 212 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 213 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 214 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 215 | 3300000471 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O11 | Metagenome | Apidae |
| 216 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 217 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 218 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 219 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 220 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 221 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 222 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 223 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 224 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 225 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 226 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 227 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 228 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 229 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 230 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 231 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 232 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 233 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 234 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 235 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 236 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 237 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 238 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 239 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 240 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 241 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 242 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 243 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 244 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 245 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 246 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 247 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 248 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 249 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 250 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 251 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 252 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 253 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 254 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 255 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 256 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 257 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 258 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 259 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 260 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 261 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 262 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 263 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 264 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 265 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 266 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 267 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 268 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 269 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 270 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 271 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 272 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 273 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 274 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 275 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 276 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 277 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 278 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 279 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 280 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 281 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 282 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 283 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 284 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 285 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 286 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 287 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 288 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_208167 | 3300042611 | Bacteria | 1512 |
| 2 | Ga0466701_031100 | 3300042598 | Bacteria | 41610 |
| 3 | Ga0466717_166095 | 3300042604 | Bacteria | 3752 |
| 4 | Ga0466717_300656 | 3300042604 | Bacteria | 4224 |
| 5 | Ga0160435_1005293 | 3300012857 | Bacteria | 2935 |
| 6 | Ga0466657_313449 | 3300042582 | Bacteria | 4846 |
| 7 | Ga0466691_148996 | 3300042593 | Bacteria | 5072 |
| 8 | Ga0123356_10006350 | 3300010049 | Bacteria | 11931 |
| 9 | Ga0123353_10839903 | 3300010167 | Bacteria | 1261 |
| 10 | JGI24702J35022_10000140 | 3300002462 | Bacteria | 36227 |
| 11 | Ga0102734_1000394 | 3300007129 | Bacteria | 18951 |
| 12 | Ga0102740_1000344 | 3300007140 | Bacteria | 13143 |
| 13 | Ga0102738_1000014 | 3300007141 | Bacteria | 90212 |
| 14 | Ga0103267_1000048 | 3300007190 | Bacteria | 42558 |
| 15 | Ga0103268_1000058 | 3300007192 | Unclassified | 45199 |
| 16 | Ga0103268_1002585 | 3300007192 | Bacteria | 3977 |
| 17 | Ga0466705_439247 | 3300042612 | Bacteria | 14523 |
| 18 | Ga0466715_188600 | 3300042616 | Bacteria | 57064 |
| 19 | Ga0466734_106010 | 3300042623 | Bacteria | 1126 |
| 20 | Ga0466730_048744 | 3300042625 | Bacteria | 17324 |
| 21 | Ga0466704_129264 | 3300042643 | Bacteria | 53504 |
| 22 | Ga0466704_337094 | 3300042643 | Bacteria | 1883 |
| 23 | Ga0466724_53791 | 3300042649 | Bacteria | 252935 |
| 24 | Ga0466725_130658 | 3300042654 | Bacteria | 28019 |
| 25 | Ga0466697_205832 | 3300042611 | Bacteria | 1174 |
| 26 | Ga0466732_331100 | 3300042656 | Bacteria | 3902 |
| 27 | Ga0466700_163296 | 3300042600 | Bacteria | 1086 |
| 28 | Ga0160444_100329 | 3300012841 | Bacteria | 29885 |
| 29 | Ga0160434_114619 | 3300012850 | Unclassified | 1247 |
| 30 | Ga0466657_035045 | 3300042582 | Bacteria | 1495 |
| 31 | Ga0466690_311623 | 3300042590 | Bacteria | 1785 |
| 32 | Ga0466701_001027 | 3300042598 | Bacteria | 90142 |
| 33 | JGI24705J35276_12236675 | 3300002504 | Bacteria | 8590 |
| 34 | JGI24696J40584_12925111 | 3300002834 | Unclassified | 1396 |
| 35 | Ga0072941_1302854 | 3300005201 | Bacteria | 1305 |
| 36 | Ga0074278_134885 | 3300005721 | Bacteria | 11312 |
| 37 | Ga0466723_070255 | 3300042618 | Bacteria | 28764 |
| 38 | Ga0466729_301368 | 3300042621 | Bacteria | 4480 |
| 39 | Ga0466724_64883 | 3300042649 | Bacteria | 8556 |
| 40 | Ga0466708_039221 | 3300042652 | Bacteria | 28926 |
| 41 | Ga0466725_015529 | 3300042654 | Bacteria | 5393 |
| 42 | Ga0466725_155090 | 3300042654 | Bacteria | 5780 |
| 43 | Ga0466697_120373 | 3300042611 | Bacteria | 4896 |
| 44 | Ga0466706_223664 | 3300042599 | Bacteria | 8951 |
| 45 | Ga0466707_211261 | 3300042601 | Bacteria | 4664 |
| 46 | Ga0160452_100080 | 3300012834 | Bacteria | 127985 |
| 47 | Ga0160446_101144 | 3300012835 | Bacteria | 6361 |
| 48 | Ga0160472_101047 | 3300012839 | Bacteria | 9671 |
| 49 | Ga0160460_101604 | 3300012845 | Unclassified | 7060 |
| 50 | Ga0160436_1021549 | 3300012861 | Unclassified | 1211 |
| 51 | Ga0466657_164723 | 3300042582 | Bacteria | 16447 |
| 52 | Ga0466657_316672 | 3300042582 | Unclassified | 5128 |
| 53 | Ga0466690_043277 | 3300042590 | Bacteria | 6235 |
| 54 | Ga0466691_018600 | 3300042593 | Bacteria | 11518 |
| 55 | Ga0466695_382854 | 3300042595 | Bacteria | 6101 |
| 56 | Ga0123353_10013547 | 3300010167 | Bacteria | 11688 |
| 57 | Ga0123354_10017888 | 3300010882 | Bacteria | 11105 |
| 58 | Ga0123354_10088373 | 3300010882 | Bacteria | 4310 |
| 59 | Ga0160466_100167 | 3300012809 | Bacteria | 51690 |
| 60 | IMNBL1DRAFT_c0002740 | 3300000062 | Bacteria | 11986 |
| 61 | SCG598O11_12592 | 3300000471 | Bacteria | 74107 |
| 62 | CVPL005W_1000161 | 3300002934 | Bacteria | 29057 |
| 63 | CVPL005W_1000848 | 3300002934 | Bacteria | 10103 |
| 64 | Ga0068302_10008357 | 3300005071 | Bacteria | 5128 |
| 65 | Ga0123357_10000009 | 3300009784 | Bacteria | 204245 |
| 66 | Ga0466710_058672 | 3300042613 | Bacteria | 2207 |
| 67 | Ga0466710_064510 | 3300042613 | Bacteria | 7350 |
| 68 | Ga0466731_020408 | 3300042622 | Bacteria | 6221 |
| 69 | Ga0466731_363591 | 3300042622 | Bacteria | 7550 |
| 70 | Ga0466704_612360 | 3300042643 | Bacteria | 42225 |
| 71 | Ga0466708_432759 | 3300042652 | Bacteria | 8904 |
| 72 | Ga0466697_160556 | 3300042611 | Bacteria | 5601 |
| 73 | Ga0466701_030422 | 3300042598 | Bacteria | 26832 |
| 74 | Ga0466706_187237 | 3300042599 | Bacteria | 5828 |
| 75 | Ga0466707_415157 | 3300042601 | Bacteria | 4719 |
| 76 | Ga0466713_004999 | 3300042602 | Bacteria | 4001 |
| 77 | Ga0466721_033152 | 3300042608 | Bacteria | 2242 |
| 78 | Ga0160452_104593 | 3300012834 | Bacteria | 2143 |
| 79 | Ga0160445_100130 | 3300012847 | Bacteria | 65602 |
| 80 | Ga0466657_007414 | 3300042582 | Bacteria | 38615 |
| 81 | Ga0466690_091849 | 3300042590 | Bacteria | 20372 |
| 82 | Ga0466692_152893 | 3300042591 | Bacteria | 110459 |
| 83 | Ga0466701_005992 | 3300042598 | Bacteria | 3437 |
| 84 | Ga0123357_10118774 | 3300009784 | Bacteria | 3340 |
| 85 | Ga0123354_10159926 | 3300010882 | Bacteria | 2680 |
| 86 | Ga0103264_1000339 | 3300007188 | Bacteria | 41125 |
| 87 | Ga0466710_186618 | 3300042613 | Bacteria | 8637 |
| 88 | Ga0466715_441999 | 3300042616 | Bacteria | 11101 |
| 89 | Ga0466734_045406 | 3300042623 | Bacteria | 27659 |
| 90 | Ga0466730_060188 | 3300042625 | Bacteria | 807184 |
| 91 | Ga0466730_092809 | 3300042625 | Bacteria | 164860 |
| 92 | Ga0466703_018295 | 3300042636 | Bacteria | 10872 |
| 93 | Ga0466703_125050 | 3300042636 | Bacteria | 41270 |
| 94 | Ga0466709_408176 | 3300042648 | Bacteria | 55853 |
| 95 | Ga0466724_23079 | 3300042649 | Bacteria | 108720 |
| 96 | Ga0466708_061169 | 3300042652 | Bacteria | 6411 |
| 97 | Ga0466727_324151 | 3300042655 | Bacteria | 5521 |
| 98 | Ga0466701_050445 | 3300042598 | Bacteria | 5916 |
| 99 | Ga0466706_008717 | 3300042599 | Bacteria | 4641 |
| 100 | Ga0466707_387511 | 3300042601 | Bacteria | 35570 |
| 101 | Ga0466719_047066 | 3300042606 | Bacteria | 5295 |
| 102 | Ga0466719_104411 | 3300042606 | Bacteria | 9619 |
| 103 | Ga0466719_263549 | 3300042606 | Bacteria | 6450 |
| 104 | Ga0466690_047294 | 3300042590 | Bacteria | 25739 |
| 105 | Ga0466692_026545 | 3300042591 | Bacteria | 17802 |
| 106 | Ga0466693_186576 | 3300042592 | Bacteria | 3802 |
| 107 | CVPL010W_10011084 | 3300002931 | Bacteria | 7616 |
| 108 | Ga0072941_1201159 | 3300005201 | Bacteria | 14308 |
| 109 | Ga0103263_101499 | 3300007042 | Bacteria | 3011 |
| 110 | Ga0102734_1021584 | 3300007129 | Bacteria | 1609 |
| 111 | Ga0123357_10000166 | 3300009784 | Bacteria | 60077 |
| 112 | Ga0466710_077482 | 3300042613 | Bacteria | 1146 |
| 113 | Ga0466703_190095 | 3300042636 | Bacteria | 7692 |
| 114 | Ga0466703_405453 | 3300042636 | Bacteria | 3991 |
| 115 | Ga0466708_246604 | 3300042652 | Bacteria | 12195 |
| 116 | Ga0466697_088283 | 3300042611 | Bacteria | 4306 |
| 117 | Ga0466701_092696 | 3300042598 | Bacteria | 3916 |
| 118 | Ga0466701_097716 | 3300042598 | Bacteria | 10115 |
| 119 | Ga0466713_134686 | 3300042602 | Bacteria | 8005 |
| 120 | Ga0466722_127514 | 3300042609 | Bacteria | 20011 |
| 121 | Ga0160453_100295 | 3300012814 | Bacteria | 45561 |
| 122 | Ga0160458_100823 | 3300012832 | Bacteria | 8852 |
| 123 | Ga0160447_103563 | 3300012849 | Unclassified | 4928 |
| 124 | Ga0160435_1006289 | 3300012857 | Bacteria | 2637 |
| 125 | Ga0466657_016469 | 3300042582 | Bacteria | 1859 |
| 126 | Ga0466657_053073 | 3300042582 | Bacteria | 114727 |
| 127 | Ga0466657_230081 | 3300042582 | Bacteria | 6532 |
| 128 | Ga0466693_403621 | 3300042592 | Bacteria | 4843 |
| 129 | Ga0466695_345578 | 3300042595 | Unclassified | 1945 |
| 130 | Ga0123356_10012404 | 3300010049 | Bacteria | 8270 |
| 131 | Ga0123354_10060087 | 3300010882 | Bacteria | 5629 |
| 132 | Ga0102737_1000282 | 3300007142 | Bacteria | 17189 |
| 133 | Ga0105553_1034060 | 3300007767 | Bacteria | 30414 |
| 134 | Ga0466710_046283 | 3300042613 | Bacteria | 1600 |
| 135 | Ga0466710_327373 | 3300042613 | Bacteria | 30738 |
| 136 | Ga0466715_624705 | 3300042616 | Bacteria | 2260 |
| 137 | Ga0466718_013517 | 3300042617 | Bacteria | 2492 |
| 138 | Ga0466723_024186 | 3300042618 | Bacteria | 12390 |
| 139 | Ga0466726_410189 | 3300042619 | Bacteria | 5857 |
| 140 | Ga0466729_060751 | 3300042621 | Bacteria | 49540 |
| 141 | Ga0466731_276892 | 3300042622 | Bacteria | 12970 |
| 142 | Ga0466734_023590 | 3300042623 | Bacteria | 20157 |
| 143 | Ga0466730_078377 | 3300042625 | Bacteria | 7606 |
| 144 | Ga0466730_082993 | 3300042625 | Unclassified | 1883 |
| 145 | Ga0466725_069031 | 3300042654 | Bacteria | 10014 |
| 146 | Ga0466701_093553 | 3300042598 | Bacteria | 2089 |
| 147 | Ga0466719_166313 | 3300042606 | Bacteria | 6000 |
| 148 | Ga0160470_101260 | 3300012813 | Bacteria | 6484 |
| 149 | Ga0160446_102715 | 3300012835 | Bacteria | 2992 |
| 150 | Ga0160460_100956 | 3300012845 | Bacteria | 12247 |
| 151 | Ga0466657_043850 | 3300042582 | Bacteria | 2398 |
| 152 | Ga0466657_268417 | 3300042582 | Bacteria | 4900 |
| 153 | Ga0466693_312324 | 3300042592 | Bacteria | 1047 |
| 154 | Ga0466693_315366 | 3300042592 | Bacteria | 2725 |
| 155 | Ga0466693_412336 | 3300042592 | Bacteria | 5553 |
| 156 | Ga0466691_123685 | 3300042593 | Bacteria | 2723 |
| 157 | Ga0123353_10113001 | 3300010167 | Bacteria | 4372 |
| 158 | Ga0123354_10005039 | 3300010882 | Bacteria | 19030 |
| 159 | Ga0160464_100135 | 3300012805 | Bacteria | 81696 |
| 160 | IMNBGM34_c000040 | 3300000036 | Bacteria | 36196 |
| 161 | CVPL010W_10012860 | 3300002931 | Bacteria | 9544 |
| 162 | CVPL005L_10002051 | 3300002938 | Bacteria | 23190 |
| 163 | Ga0072941_1072060 | 3300005201 | Bacteria | 12085 |
| 164 | Ga0103266_1000027 | 3300007067 | Bacteria | 79635 |
| 165 | Ga0466711_316690 | 3300042615 | Bacteria | 2002 |
| 166 | Ga0466715_347425 | 3300042616 | Bacteria | 12253 |
| 167 | Ga0466731_010680 | 3300042622 | Bacteria | 2111 |
| 168 | Ga0466734_012396 | 3300042623 | Bacteria | 2576 |
| 169 | Ga0466734_018438 | 3300042623 | Bacteria | 9258 |
| 170 | Ga0466724_08867 | 3300042649 | Bacteria | 1739 |
| 171 | Ga0466724_29472 | 3300042649 | Bacteria | 417400 |
| 172 | Ga0466724_64082 | 3300042649 | Bacteria | 15086 |
| 173 | Ga0466708_094516 | 3300042652 | Bacteria | 18209 |
| 174 | Ga0466708_383995 | 3300042652 | Bacteria | 1615 |
| 175 | Ga0466725_084988 | 3300042654 | Bacteria | 8604 |
| 176 | Ga0466725_315700 | 3300042654 | Bacteria | 39714 |
| 177 | Ga0466733_069234 | 3300042659 | Bacteria | 27333 |
| 178 | Ga0466701_022011 | 3300042598 | Bacteria | 293822 |
| 179 | Ga0466701_047531 | 3300042598 | Bacteria | 58092 |
| 180 | Ga0466717_303202 | 3300042604 | Bacteria | 2602 |
| 181 | Ga0466719_268927 | 3300042606 | Bacteria | 3680 |
| 182 | Ga0160459_100859 | 3300012831 | Bacteria | 9635 |
| 183 | Ga0466657_273514 | 3300042582 | Bacteria | 2135 |
| 184 | CVPL010W_10012734 | 3300002931 | Bacteria | 6611 |
| 185 | CVPL005L_10000045 | 3300002938 | Bacteria | 74927 |
| 186 | Ga0466710_123053 | 3300042613 | Bacteria | 6068 |
| 187 | Ga0466710_361536 | 3300042613 | Bacteria | 65742 |
| 188 | Ga0466712_044018 | 3300042614 | Bacteria | 4648 |
| 189 | Ga0466711_245117 | 3300042615 | Bacteria | 33992 |
| 190 | Ga0466718_106441 | 3300042617 | Bacteria | 1494 |
| 191 | Ga0466726_333872 | 3300042619 | Bacteria | 2145 |
| 192 | Ga0466728_066286 | 3300042620 | Bacteria | 9039 |
| 193 | Ga0466734_093027 | 3300042623 | Bacteria | 2967 |
| 194 | Ga0466708_186365 | 3300042652 | Unclassified | 3082 |
| 195 | Ga0466708_390363 | 3300042652 | Bacteria | 16794 |
| 196 | Ga0466725_010440 | 3300042654 | Bacteria | 37328 |
| 197 | Ga0466725_089901 | 3300042654 | Bacteria | 13182 |
| 198 | Ga0466725_245489 | 3300042654 | Bacteria | 6225 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00005 | ABC_tran | ABC transporter | 77 | 226 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.