Protein Family IF08569
Metagenome
Isolate
153
Members
109
Samples
105
Scaffolds
262.86
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_304931|Ga0466729_304931_297_1163
- Length
- 288 aa
- Sequence
- LTAAGFNTPFCSGIPGTEFMSVPIRVAIAGASGRMGRMLIEAALQDEGIVLASAFDRPGSAFIGRDAGEAAGVASGVTIIDDASAAIAAADCLIDFTRPEGTLAHLGEAVRFGKSAVIGTTGFDAAGKAAIAEAARSVPVVFAPNMAVGVNAVFRLLEVAAKILSKGYDVEVIEAHHRFKVDAPSGTALRMGEVVARAMGRDLGECAIYGREGVTGERKPETIGFSAIRGGDVVGDHTVLFAGIGERIEITHQSGSRMPYALGSLRAARFLAGRAPGLFDMQDVLGLR
Sample Types
Isolate
31.4%
Metagenome
68.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
19.8%
Apidae
17.8%
Termitidae
17.8%
Kalotermitidae
11.9%
Culicidae
5.9%
Armadillidiidae
5.0%
Elmidae
4.0%
Rhinotermitidae
4.0%
Curculionidae
4.0%
Passalidae
3.0%
Termopsidae
2.0%
Lysianassidae
1.0%
Hodotermitidae
1.0%
Siricidae
1.0%
Gryllidae
1.0%
Drosophilidae
1.0%
Taxonomy
Archaea
0
Bacteria
143
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 2 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 3 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 4 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 5 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 6 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 7 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 17 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 21 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 22 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 23 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 24 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 25 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 33 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 34 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 35 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 36 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 37 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 44 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 45 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 46 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 47 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 48 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 49 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 50 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 51 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 52 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 53 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 54 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 59 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 60 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 61 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 62 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 63 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 65 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 66 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 67 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 68 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 69 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 70 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 71 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 72 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 73 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 74 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 75 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 76 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 77 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 78 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 79 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 80 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 81 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 82 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 83 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 84 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 85 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 86 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 87 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 88 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 89 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 90 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 91 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 92 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 93 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 94 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 95 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 96 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 97 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 98 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 99 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 100 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 101 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 102 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 103 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 104 | 2528768159 | Alteromonadaceae bacterium Bs31 | Isolate | Unclassified |
| 105 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 106 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 107 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 108 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 109 | 8035422605 | Pseudomonas monteilii CY06 | Isolate |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_019599 | 3300042656 | Bacteria | 1857 |
| 2 | Ga0123357_10312737 | 3300009784 | Bacteria | 1566 |
| 3 | Ga0123355_10012885 | 3300009826 | Unclassified | 12979 |
| 4 | Ga0123353_10015594 | 3300010167 | Bacteria | 11053 |
| 5 | Ga0160471_100049 | 3300012812 | Bacteria | 163291 |
| 6 | SWWA_contig31839__length_5123___numreads_351 | 2100351016 | Bacteria | 5123 |
| 7 | Ga0123357_10000908 | 3300009784 | Bacteria | 30102 |
| 8 | Ga0466723_270128 | 3300042618 | Bacteria | 34165 |
| 9 | Ga0466726_159397 | 3300042619 | Bacteria | 36011 |
| 10 | Ga0466729_067268 | 3300042621 | Bacteria | 33521 |
| 11 | Ga0466703_054978 | 3300042636 | Bacteria | 1966 |
| 12 | Ga0466704_258426 | 3300042643 | Bacteria | 95131 |
| 13 | Ga0160469_105661 | 3300012824 | Bacteria | 1293 |
| 14 | Ga0466717_071135 | 3300042604 | Unclassified | 3614 |
| 15 | Ga0466719_295496 | 3300042606 | Bacteria | 3440 |
| 16 | Ga0466722_259999 | 3300042609 | Bacteria | 18788 |
| 17 | Ga0123356_10222709 | 3300010049 | Bacteria | 1944 |
| 18 | Ga0123353_10077558 | 3300010167 | Bacteria | 5339 |
| 19 | SPBB_contig09015 | 2044078006 | Bacteria | 21466 |
| 20 | JGI24702J35022_10014840 | 3300002462 | Bacteria | 4292 |
| 21 | Ga0466726_279079 | 3300042619 | Bacteria | 1330 |
| 22 | Ga0466729_304931 | 3300042621 | Bacteria | 1240 |
| 23 | Ga0466724_58564 | 3300042649 | Bacteria | 10323 |
| 24 | Ga0160445_101633 | 3300012847 | Bacteria | 6033 |
| 25 | Ga0466706_234433 | 3300042599 | Bacteria | 7625 |
| 26 | Ga0123353_10229218 | 3300010167 | Bacteria | 2898 |
| 27 | FGTW_contig31070 | 2065487013 | Bacteria | 6211 |
| 28 | HBC_ctgsDRAFT_1000761 | 3300000333 | Bacteria | 7162 |
| 29 | JGI24705J35276_12238466 | 3300002504 | Unclassified | 23115 |
| 30 | Ga0466728_062815 | 3300042620 | Bacteria | 69433 |
| 31 | Ga0466725_282494 | 3300042654 | Bacteria | 6446 |
| 32 | Ga0466706_066534 | 3300042599 | Bacteria | 37675 |
| 33 | Ga0466705_079285 | 3300042612 | Bacteria | 5370 |
| 34 | DPOL_contig13647 | 2035918003 | Bacteria | 9812 |
| 35 | 2227174980 | 2225789004 | Bacteria | 1511 |
| 36 | IMNBGM34_c000054 | 3300000036 | Bacteria | 32127 |
| 37 | JGI24702J35022_10000909 | 3300002462 | Bacteria | 18428 |
| 38 | Ga0466715_137614 | 3300042616 | Bacteria | 38477 |
| 39 | Ga0160470_101759 | 3300012813 | Bacteria | 4795 |
| 40 | Ga0160468_101680 | 3300012819 | Bacteria | 4928 |
| 41 | Ga0160448_103465 | 3300012854 | Bacteria | 4603 |
| 42 | Ga0160448_106173 | 3300012854 | Unclassified | 3033 |
| 43 | Ga0466706_261649 | 3300042599 | Bacteria | 15885 |
| 44 | Ga0466714_111184 | 3300042603 | Bacteria | 1338 |
| 45 | Ga0123353_10111167 | 3300010167 | Unclassified | 4413 |
| 46 | Ga0466727_169080 | 3300042655 | Bacteria | 19731 |
| 47 | Ga0160472_100109 | 3300012839 | Bacteria | 129853 |
| 48 | Ga0466657_191819 | 3300042582 | Bacteria | 13756 |
| 49 | Ga0466657_396192 | 3300042582 | Bacteria | 43448 |
| 50 | Ga0466692_076165 | 3300042591 | Bacteria | 58218 |
| 51 | Ga0466691_055841 | 3300042593 | Bacteria | 7993 |
| 52 | Ga0466707_151113 | 3300042601 | Bacteria | 11427 |
| 53 | Ga0466716_196380 | 3300042605 | Bacteria | 1082 |
| 54 | Ga0123356_10336606 | 3300010049 | Bacteria | 1628 |
| 55 | Ga0123353_10363498 | 3300010167 | Bacteria | 2173 |
| 56 | Ga0123353_10960511 | 3300010167 | Bacteria | 1154 |
| 57 | SWWA_contig19739__length_2482___numreads_46 | 2100351016 | Bacteria | 2482 |
| 58 | Ga0466715_509823 | 3300042616 | Unclassified | 5603 |
| 59 | Ga0466703_249289 | 3300042636 | Bacteria | 1404 |
| 60 | Ga0466709_399485 | 3300042648 | Bacteria | 5797 |
| 61 | Ga0160470_101021 | 3300012813 | Bacteria | 7661 |
| 62 | Ga0160453_102988 | 3300012814 | Unclassified | 3749 |
| 63 | Ga0160441_102417 | 3300012825 | Unclassified | 3815 |
| 64 | Ga0160433_100090 | 3300012846 | Bacteria | 92891 |
| 65 | Ga0466657_020368 | 3300042582 | Bacteria | 10005 |
| 66 | Ga0466657_079329 | 3300042582 | Bacteria | 10810 |
| 67 | Ga0466690_180938 | 3300042590 | Bacteria | 11015 |
| 68 | Ga0466695_304326 | 3300042595 | Bacteria | 3812 |
| 69 | Ga0466696_328576 | 3300042596 | Bacteria | 3306 |
| 70 | Ga0466701_018917 | 3300042598 | Bacteria | 69268 |
| 71 | Ga0466714_117517 | 3300042603 | Bacteria | 27171 |
| 72 | Ga0466722_181429 | 3300042609 | Bacteria | 1616 |
| 73 | Ga0466733_192046 | 3300042659 | Bacteria | 57216 |
| 74 | Ga0123353_10003924 | 3300010167 | Bacteria | 19007 |
| 75 | Ga0123353_10864072 | 3300010167 | Bacteria | 1237 |
| 76 | IMNBGM34_c000635 | 3300000036 | Bacteria | 8654 |
| 77 | Ga0466715_499687 | 3300042616 | Bacteria | 9677 |
| 78 | Ga0466723_156707 | 3300042618 | Bacteria | 1467 |
| 79 | Ga0466723_210482 | 3300042618 | Bacteria | 12612 |
| 80 | Ga0466703_053190 | 3300042636 | Bacteria | 54858 |
| 81 | Ga0466704_065837 | 3300042643 | Bacteria | 2272 |
| 82 | Ga0466724_36896 | 3300042649 | Bacteria | 3239 |
| 83 | Ga0160467_100188 | 3300012829 | Bacteria | 82770 |
| 84 | Ga0160460_103181 | 3300012845 | Unclassified | 3037 |
| 85 | Ga0160447_104723 | 3300012849 | Bacteria | 3964 |
| 86 | Ga0466656_002660 | 3300042550 | Bacteria | 1367 |
| 87 | Ga0466690_075827 | 3300042590 | Bacteria | 38218 |
| 88 | Ga0466696_048527 | 3300042596 | Bacteria | 3816 |
| 89 | Ga0466713_027134 | 3300042602 | Bacteria | 18419 |
| 90 | Ga0466719_023074 | 3300042606 | Bacteria | 30350 |
| 91 | Ga0466705_087780 | 3300042612 | Bacteria | 84355 |
| 92 | Ga0123357_10019280 | 3300009784 | Bacteria | 9086 |
| 93 | Ga0160454_100689 | 3300012798 | Unclassified | 7546 |
| 94 | IMNBL1DRAFT_c0002228 | 3300000062 | Bacteria | 13675 |
| 95 | JGI24702J35022_10000399 | 3300002462 | Bacteria | 25810 |
| 96 | Ga0104049_1029226 | 3300007103 | Bacteria | 1714 |
| 97 | Ga0123357_10000003 | 3300009784 | Bacteria | 349727 |
| 98 | Ga0466710_165772 | 3300042613 | Bacteria | 122681 |
| 99 | Ga0466723_046663 | 3300042618 | Bacteria | 18278 |
| 100 | Ga0466726_133160 | 3300042619 | Bacteria | 5967 |
| 101 | Ga0466730_094350 | 3300042625 | Bacteria | 10437 |
| 102 | Ga0466709_225347 | 3300042648 | Bacteria | 2535 |
| 103 | Ga0160433_100099 | 3300012846 | Bacteria | 86801 |
| 104 | Ga0466690_051691 | 3300042590 | Bacteria | 18831 |
| 105 | Ga0466692_040554 | 3300042591 | Bacteria | 18931 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.