Protein Family IF08552
Metagenome
Isolate
266
Members
72
Samples
243
Scaffolds
406.72
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_249225|Ga0466729_249225_1041_2540
- Length
- 468 aa
- Sequence
- LFFPYENLYDYRIEQCGQKIQEAVFEIGIRVKNEASASLFLIPYSLCYNSAMNETPASVRIHIGFFGRRNAGKSSLVNAVTGQNLAIVSEVKGTTTDPVYKAMELLPLGPVVIIDTPGIDDEGALGEQRVLRAKQVLNKADVAVLVIDAQTAPTAADTDLMRLFAEKEVPFIIAYNKSDLLEENSEGERPGKTQNSMPAMAETLLRGSPSLQPPRPIFVSAKTGRNIEALKEQIAALAKTEETKLQIVADLLRPSDFVVLVVPIDKAAPKGRLILPQQQTIRDILEADAAAIVVKEYELRETLAVLGKKPRMVITDSQVFAKVSADTPRDVPLTSFSILFARYNGLLKAAVEGVAALDTLADGDAVLISEGCTHHRQCDDIGTVKLPRWIKNYTGKDITFAFTSGGDFPFDLKPYRLIVHCGGCMLTPREMRYRQKCAADQAVPITNYGILIAHIQGILERSVEMFNL
Sample Types
Isolate
8.7%
Metagenome
91.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.7%
Kalotermitidae
20.8%
Unclassified
18.1%
Blattidae
13.9%
Rhinotermitidae
5.6%
Termopsidae
4.2%
Hodotermitidae
1.4%
Pyrrhocoridae
1.4%
Taxonomy
Archaea
0
Bacteria
259
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 13 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 14 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 25 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 26 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 27 | 2820056190 | Unclassified Proteobacteria Nt197P4bin9 | Isolate | Unclassified |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2820016619 | Unclassified Spirochaetes Nt197P3bin71 | Isolate | Unclassified |
| 40 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 41 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 42 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 45 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 46 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 47 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 48 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 52 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 53 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 54 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 55 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 56 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 57 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 58 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 59 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 60 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 61 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 62 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 63 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 64 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 65 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 66 | 2820101058 | Unclassified Proteobacteria Emb289P4bin76 | Isolate | Unclassified |
| 67 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 70 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 71 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 72 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_033730 | 3300042612 | Bacteria | 25724 |
| 2 | Ga0466692_124224 | 3300042591 | Bacteria | 10124 |
| 3 | Ga0466692_176614 | 3300042591 | Bacteria | 30816 |
| 4 | Ga0466693_098638 | 3300042592 | Unclassified | 1487 |
| 5 | Ga0466691_010898 | 3300042593 | Bacteria | 10324 |
| 6 | Ga0466691_100215 | 3300042593 | Bacteria | 4203 |
| 7 | Ga0466713_154132 | 3300042602 | Bacteria | 3039 |
| 8 | Ga0466717_019929 | 3300042604 | Bacteria | 22624 |
| 9 | Ga0466719_091835 | 3300042606 | Bacteria | 7805 |
| 10 | Ga0466719_556978 | 3300042606 | Bacteria | 3296 |
| 11 | Ga0466722_017520 | 3300042609 | Bacteria | 32151 |
| 12 | Ga0466722_106807 | 3300042609 | Bacteria | 3377 |
| 13 | Ga0466722_249528 | 3300042609 | Bacteria | 2200 |
| 14 | Ga0466703_116159 | 3300042636 | Bacteria | 1596 |
| 15 | Ga0466704_123703 | 3300042643 | Bacteria | 6266 |
| 16 | Ga0466704_160025 | 3300042643 | Bacteria | 25768 |
| 17 | Ga0466709_011260 | 3300042648 | Bacteria | 85794 |
| 18 | Ga0466708_239374 | 3300042652 | Bacteria | 11100 |
| 19 | Ga0466727_087046 | 3300042655 | Bacteria | 5898 |
| 20 | Ga0466727_254305 | 3300042655 | Bacteria | 4256 |
| 21 | Ga0123355_10000366 | 3300009826 | Bacteria | 58463 |
| 22 | Ga0466705_490785 | 3300042612 | Bacteria | 1955 |
| 23 | Ga0466711_040948 | 3300042615 | Bacteria | 3405 |
| 24 | Ga0466711_136925 | 3300042615 | Bacteria | 2778 |
| 25 | Ga0466711_161959 | 3300042615 | Bacteria | 2372 |
| 26 | Ga0466711_268782 | 3300042615 | Bacteria | 8349 |
| 27 | Ga0466711_295445 | 3300042615 | Bacteria | 3686 |
| 28 | Ga0466711_504573 | 3300042615 | Bacteria | 3202 |
| 29 | Ga0466715_019061 | 3300042616 | Bacteria | 18742 |
| 30 | Ga0466715_061675 | 3300042616 | Bacteria | 23144 |
| 31 | Ga0466723_014807 | 3300042618 | Bacteria | 12268 |
| 32 | Ga0466723_127634 | 3300042618 | Bacteria | 4579 |
| 33 | Ga0466723_168282 | 3300042618 | Bacteria | 1317 |
| 34 | Ga0466723_191409 | 3300042618 | Bacteria | 2610 |
| 35 | Ga0466726_066254 | 3300042619 | Bacteria | 4442 |
| 36 | Ga0466726_484487 | 3300042619 | Bacteria | 20407 |
| 37 | Ga0466733_026672 | 3300042659 | Bacteria | 17250 |
| 38 | AustNasuHG_c1020742 | 3300000089 | Bacteria | 2136 |
| 39 | JGI24705J35276_12227599 | 3300002504 | Bacteria | 3030 |
| 40 | Ga0466692_023389 | 3300042591 | Bacteria | 4436 |
| 41 | Ga0466692_055697 | 3300042591 | Bacteria | 29527 |
| 42 | Ga0466691_181408 | 3300042593 | Bacteria | 50116 |
| 43 | Ga0466716_039165 | 3300042605 | Bacteria | 10557 |
| 44 | Ga0466719_554627 | 3300042606 | Bacteria | 3166 |
| 45 | Ga0466729_212621 | 3300042621 | Bacteria | 8578 |
| 46 | Ga0466729_301422 | 3300042621 | Bacteria | 28658 |
| 47 | Ga0466734_029222 | 3300042623 | Bacteria | 4340 |
| 48 | Ga0466704_437242 | 3300042643 | Bacteria | 12782 |
| 49 | Ga0466704_442429 | 3300042643 | Bacteria | 3768 |
| 50 | Ga0466708_040411 | 3300042652 | Bacteria | 4733 |
| 51 | Ga0466708_096821 | 3300042652 | Bacteria | 11789 |
| 52 | Ga0466708_409305 | 3300042652 | Bacteria | 12631 |
| 53 | Ga0466727_201453 | 3300042655 | Bacteria | 1625 |
| 54 | Ga0123353_10647708 | 3300010167 | Bacteria | 1497 |
| 55 | Ga0466711_043373 | 3300042615 | Bacteria | 4718 |
| 56 | Ga0466711_149952 | 3300042615 | Bacteria | 2697 |
| 57 | Ga0466715_198588 | 3300042616 | Bacteria | 16151 |
| 58 | Ga0466715_393918 | 3300042616 | Bacteria | 27422 |
| 59 | Ga0466715_519997 | 3300042616 | Bacteria | 2491 |
| 60 | Ga0466726_214344 | 3300042619 | Bacteria | 19843 |
| 61 | JGI24695J34938_10001507 | 3300002450 | Bacteria | 19641 |
| 62 | Ga0074263_116362 | 3300005485 | Bacteria | 1488 |
| 63 | Ga0456237_0000087 | 3300041968 | Bacteria | 12748 |
| 64 | Ga0466690_162226 | 3300042590 | Bacteria | 2245 |
| 65 | Ga0466692_069166 | 3300042591 | Bacteria | 25173 |
| 66 | Ga0466692_159131 | 3300042591 | Bacteria | 6383 |
| 67 | Ga0466693_418097 | 3300042592 | Bacteria | 4204 |
| 68 | Ga0466691_149240 | 3300042593 | Bacteria | 9541 |
| 69 | Ga0466694_032098 | 3300042594 | Bacteria | 12447 |
| 70 | Ga0466713_089150 | 3300042602 | Bacteria | 2530 |
| 71 | Ga0466714_115445 | 3300042603 | Bacteria | 9299 |
| 72 | Ga0466716_121851 | 3300042605 | Bacteria | 4352 |
| 73 | Ga0466719_305351 | 3300042606 | Bacteria | 6010 |
| 74 | Ga0466719_314297 | 3300042606 | Bacteria | 13268 |
| 75 | Ga0466719_532466 | 3300042606 | Bacteria | 2504 |
| 76 | Ga0466722_038042 | 3300042609 | Bacteria | 14028 |
| 77 | Ga0466731_253510 | 3300042622 | Bacteria | 1294 |
| 78 | Ga0466702_032714 | 3300042635 | Bacteria | 1685 |
| 79 | Ga0466703_239168 | 3300042636 | Bacteria | 18053 |
| 80 | Ga0466709_139300 | 3300042648 | Bacteria | 1615 |
| 81 | Ga0466708_025584 | 3300042652 | Bacteria | 69850 |
| 82 | Ga0123355_10022931 | 3300009826 | Bacteria | 10011 |
| 83 | Ga0123353_10005203 | 3300010167 | Bacteria | 17009 |
| 84 | Ga0123353_10145760 | 3300010167 | Bacteria | 3786 |
| 85 | Ga0466705_423705 | 3300042612 | Bacteria | 8774 |
| 86 | Ga0466711_110010 | 3300042615 | Bacteria | 12211 |
| 87 | Ga0466711_117401 | 3300042615 | Bacteria | 19297 |
| 88 | Ga0466715_194200 | 3300042616 | Bacteria | 12611 |
| 89 | Ga0466718_147338 | 3300042617 | Unclassified | 1568 |
| 90 | Ga0466723_144938 | 3300042618 | Bacteria | 3626 |
| 91 | Ga0466723_277865 | 3300042618 | Bacteria | 23847 |
| 92 | Ga0466726_334931 | 3300042619 | Bacteria | 11384 |
| 93 | Ga0466705_316603 | 3300042612 | Bacteria | 56122 |
| 94 | JGI24695J34938_10062846 | 3300002450 | Bacteria | 1576 |
| 95 | Ga0456237_0000900 | 3300041968 | Bacteria | 4671 |
| 96 | Ga0466690_171379 | 3300042590 | Bacteria | 7258 |
| 97 | Ga0466692_023781 | 3300042591 | Bacteria | 21532 |
| 98 | Ga0466691_051000 | 3300042593 | Bacteria | 1947 |
| 99 | Ga0466696_027711 | 3300042596 | Bacteria | 17799 |
| 100 | Ga0466707_381861 | 3300042601 | Bacteria | 2556 |
| 101 | Ga0466713_112775 | 3300042602 | Bacteria | 2851 |
| 102 | Ga0466720_048989 | 3300042607 | Bacteria | 13959 |
| 103 | Ga0466722_144774 | 3300042609 | Bacteria | 23493 |
| 104 | Ga0466727_079987 | 3300042655 | Bacteria | 1649 |
| 105 | Ga0123356_10022847 | 3300010049 | Bacteria | 5899 |
| 106 | Ga0123353_10001653 | 3300010167 | Bacteria | 27425 |
| 107 | Ga0123353_10234318 | 3300010167 | Bacteria | 2859 |
| 108 | Ga0466711_335512 | 3300042615 | Bacteria | 5766 |
| 109 | Ga0466715_068958 | 3300042616 | Bacteria | 2628 |
| 110 | Ga0466715_138377 | 3300042616 | Bacteria | 3568 |
| 111 | Ga0466718_151657 | 3300042617 | Bacteria | 3401 |
| 112 | Ga0466726_434498 | 3300042619 | Bacteria | 1482 |
| 113 | Ga0072940_1119742 | 3300005200 | Bacteria | 1900 |
| 114 | Ga0466690_170932 | 3300042590 | Bacteria | 11021 |
| 115 | Ga0466692_008546 | 3300042591 | Bacteria | 2926 |
| 116 | Ga0466692_149343 | 3300042591 | Bacteria | 5939 |
| 117 | Ga0466692_172136 | 3300042591 | Bacteria | 2667 |
| 118 | Ga0466694_196713 | 3300042594 | Bacteria | 2073 |
| 119 | Ga0466696_039042 | 3300042596 | Bacteria | 4740 |
| 120 | Ga0466696_384458 | 3300042596 | Unclassified | 1388 |
| 121 | Ga0466699_290040 | 3300042597 | Bacteria | 4229 |
| 122 | Ga0466707_208999 | 3300042601 | Bacteria | 1926 |
| 123 | Ga0466707_376196 | 3300042601 | Bacteria | 7386 |
| 124 | Ga0466717_069478 | 3300042604 | Bacteria | 3001 |
| 125 | Ga0466716_082524 | 3300042605 | Bacteria | 8985 |
| 126 | Ga0466719_063086 | 3300042606 | Bacteria | 15781 |
| 127 | Ga0466719_077743 | 3300042606 | Bacteria | 2476 |
| 128 | Ga0466720_020964 | 3300042607 | Bacteria | 29964 |
| 129 | Ga0466722_023781 | 3300042609 | Bacteria | 6478 |
| 130 | Ga0466735_125390 | 3300042624 | Bacteria | 50227 |
| 131 | Ga0466735_210072 | 3300042624 | Bacteria | 1604 |
| 132 | Ga0466702_374431 | 3300042635 | Bacteria | 2949 |
| 133 | Ga0466703_302657 | 3300042636 | Bacteria | 56159 |
| 134 | Ga0466703_431651 | 3300042636 | Bacteria | 2571 |
| 135 | Ga0466704_067227 | 3300042643 | Bacteria | 6197 |
| 136 | Ga0466704_151582 | 3300042643 | Bacteria | 5333 |
| 137 | Ga0466709_251233 | 3300042648 | Bacteria | 4212 |
| 138 | Ga0466709_390830 | 3300042648 | Bacteria | 2433 |
| 139 | Ga0466727_110920 | 3300042655 | Bacteria | 1829 |
| 140 | Ga0123353_10005296 | 3300010167 | Bacteria | 16886 |
| 141 | Ga0123353_10006314 | 3300010167 | Bacteria | 15763 |
| 142 | Ga0466712_297457 | 3300042614 | Bacteria | 1520 |
| 143 | Ga0466715_305337 | 3300042616 | Bacteria | 16941 |
| 144 | Ga0466718_086869 | 3300042617 | Bacteria | 2840 |
| 145 | Ga0466723_001084 | 3300042618 | Bacteria | 7064 |
| 146 | Ga0466723_013878 | 3300042618 | Bacteria | 4096 |
| 147 | Ga0466723_225855 | 3300042618 | Bacteria | 4676 |
| 148 | Ga0466726_345772 | 3300042619 | Bacteria | 3030 |
| 149 | Ga0466726_461788 | 3300042619 | Bacteria | 3119 |
| 150 | Ga0466705_059657 | 3300042612 | Bacteria | 2937 |
| 151 | Ga0466705_098559 | 3300042612 | Bacteria | 5315 |
| 152 | Ga0466691_027226 | 3300042593 | Bacteria | 2893 |
| 153 | Ga0466706_020823 | 3300042599 | Bacteria | 6531 |
| 154 | Ga0466706_205656 | 3300042599 | Bacteria | 9120 |
| 155 | Ga0466719_544018 | 3300042606 | Bacteria | 1622 |
| 156 | Ga0466719_569262 | 3300042606 | Bacteria | 1944 |
| 157 | Ga0466720_092023 | 3300042607 | Bacteria | 1692 |
| 158 | Ga0466722_194794 | 3300042609 | Bacteria | 16591 |
| 159 | Ga0466735_007128 | 3300042624 | Bacteria | 3339 |
| 160 | Ga0466702_315087 | 3300042635 | Bacteria | 1737 |
| 161 | Ga0466704_322414 | 3300042643 | Bacteria | 3892 |
| 162 | Ga0466708_212877 | 3300042652 | Bacteria | 79784 |
| 163 | Ga0123353_10003084 | 3300010167 | Bacteria | 20881 |
| 164 | Ga0466711_356421 | 3300042615 | Bacteria | 13677 |
| 165 | Ga0466711_509681 | 3300042615 | Bacteria | 6395 |
| 166 | Ga0466715_390638 | 3300042616 | Bacteria | 27328 |
| 167 | Ga0466715_441190 | 3300042616 | Bacteria | 1917 |
| 168 | Ga0466723_026465 | 3300042618 | Bacteria | 8407 |
| 169 | Ga0466723_047735 | 3300042618 | Bacteria | 3123 |
| 170 | Ga0466723_066987 | 3300042618 | Bacteria | 43716 |
| 171 | Ga0466723_315519 | 3300042618 | Bacteria | 10265 |
| 172 | Ga0466726_113458 | 3300042619 | Bacteria | 4369 |
| 173 | Ga0466729_179619 | 3300042621 | Bacteria | 6770 |
| 174 | Ga0466705_193178 | 3300042612 | Unclassified | 2232 |
| 175 | Ga0466705_195902 | 3300042612 | Bacteria | 57934 |
| 176 | Ga0466705_253748 | 3300042612 | Bacteria | 4686 |
| 177 | Ga0068305_10057414 | 3300005083 | Bacteria | 8076 |
| 178 | Ga0123357_10001011 | 3300009784 | Unclassified | 28809 |
| 179 | Ga0466692_150809 | 3300042591 | Bacteria | 85319 |
| 180 | Ga0466706_199617 | 3300042599 | Bacteria | 2154 |
| 181 | Ga0466707_251534 | 3300042601 | Bacteria | 57777 |
| 182 | Ga0466717_048819 | 3300042604 | Bacteria | 1981 |
| 183 | Ga0466717_099022 | 3300042604 | Bacteria | 2356 |
| 184 | Ga0466716_236190 | 3300042605 | Bacteria | 7802 |
| 185 | Ga0466719_544986 | 3300042606 | Bacteria | 2230 |
| 186 | Ga0466698_343212 | 3300042610 | Bacteria | 3662 |
| 187 | Ga0466729_249225 | 3300042621 | Bacteria | 2583 |
| 188 | Ga0466735_004547 | 3300042624 | Bacteria | 5564 |
| 189 | Ga0466703_104120 | 3300042636 | Bacteria | 9653 |
| 190 | Ga0466704_196247 | 3300042643 | Bacteria | 5294 |
| 191 | Ga0466709_037764 | 3300042648 | Bacteria | 11848 |
| 192 | Ga0466708_098135 | 3300042652 | Bacteria | 4677 |
| 193 | Ga0466708_146465 | 3300042652 | Bacteria | 27247 |
| 194 | Ga0466708_237992 | 3300042652 | Bacteria | 2003 |
| 195 | Ga0466708_404975 | 3300042652 | Bacteria | 13428 |
| 196 | Ga0466727_030916 | 3300042655 | Bacteria | 6937 |
| 197 | Ga0466727_296688 | 3300042655 | Bacteria | 2224 |
| 198 | Ga0123356_10168098 | 3300010049 | Bacteria | 2200 |
| 199 | Ga0123353_10010038 | 3300010167 | Bacteria | 13153 |
| 200 | Ga0466711_054097 | 3300042615 | Bacteria | 6295 |
| 201 | Ga0466711_281384 | 3300042615 | Bacteria | 9652 |
| 202 | Ga0466715_169142 | 3300042616 | Bacteria | 13957 |
| 203 | Ga0466715_194664 | 3300042616 | Bacteria | 9100 |
| 204 | Ga0466715_554316 | 3300042616 | Bacteria | 46922 |
| 205 | Ga0466718_168471 | 3300042617 | Bacteria | 3157 |
| 206 | Ga0466723_047270 | 3300042618 | Bacteria | 2963 |
| 207 | Ga0466723_053515 | 3300042618 | Bacteria | 12941 |
| 208 | Ga0466723_335864 | 3300042618 | Bacteria | 5968 |
| 209 | Ga0466726_021894 | 3300042619 | Bacteria | 5175 |
| 210 | Ga0466728_078146 | 3300042620 | Bacteria | 2322 |
| 211 | Ga0466728_226766 | 3300042620 | Bacteria | 6505 |
| 212 | Ga0466729_169592 | 3300042621 | Bacteria | 2529 |
| 213 | Ga0466705_066696 | 3300042612 | Bacteria | 21660 |
| 214 | Ga0466732_446491 | 3300042656 | Bacteria | 8700 |
| 215 | AustNasuHG_c1006647 | 3300000089 | Unclassified | 4119 |
| 216 | Ga0466691_008420 | 3300042593 | Bacteria | 9742 |
| 217 | Ga0466691_091955 | 3300042593 | Bacteria | 3159 |
| 218 | Ga0466691_108207 | 3300042593 | Bacteria | 1747 |
| 219 | Ga0466695_022545 | 3300042595 | Bacteria | 6706 |
| 220 | Ga0466695_384114 | 3300042595 | Bacteria | 6440 |
| 221 | Ga0466696_196374 | 3300042596 | Bacteria | 23288 |
| 222 | Ga0466696_485248 | 3300042596 | Bacteria | 20746 |
| 223 | Ga0466716_141332 | 3300042605 | Bacteria | 7040 |
| 224 | Ga0466719_133278 | 3300042606 | Bacteria | 4132 |
| 225 | Ga0466719_139703 | 3300042606 | Bacteria | 4192 |
| 226 | Ga0466719_231189 | 3300042606 | Bacteria | 20293 |
| 227 | Ga0466722_221975 | 3300042609 | Bacteria | 3086 |
| 228 | Ga0466703_325141 | 3300042636 | Bacteria | 2385 |
| 229 | Ga0466703_386325 | 3300042636 | Bacteria | 6272 |
| 230 | Ga0466709_089700 | 3300042648 | Bacteria | 2140 |
| 231 | Ga0466708_247404 | 3300042652 | Bacteria | 13374 |
| 232 | Ga0123356_10092347 | 3300010049 | Bacteria | 2886 |
| 233 | Ga0123353_10002197 | 3300010167 | Bacteria | 24141 |
| 234 | Ga0466705_397936 | 3300042612 | Bacteria | 40401 |
| 235 | Ga0466705_426798 | 3300042612 | Bacteria | 1805 |
| 236 | Ga0466711_420703 | 3300042615 | Bacteria | 23893 |
| 237 | Ga0466715_448262 | 3300042616 | Bacteria | 3903 |
| 238 | Ga0466715_519193 | 3300042616 | Bacteria | 6371 |
| 239 | Ga0466715_617330 | 3300042616 | Bacteria | 15264 |
| 240 | Ga0466723_137745 | 3300042618 | Unclassified | 7318 |
| 241 | Ga0466726_038317 | 3300042619 | Bacteria | 6544 |
| 242 | Ga0466726_424149 | 3300042619 | Bacteria | 5239 |
| 243 | Ga0466726_471373 | 3300042619 | Bacteria | 1159 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF18128 | HydF_dimer | Hydrogen maturase F dimerization domain | 247 | 345 | 0.99 |
| PF18133 | HydF_tetramer | Hydrogen maturase F tetramerization domain | 349 | 465 | 0.98 |
| PF01926 | MMR_HSR1 | 50S ribosome-binding GTPase | 63 | 177 | 0.9 |
| PF02421 | FeoB_N | Ferrous iron transport protein B | 62 | 184 | 0.85 |
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 112 | 237 | 0.74 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01926 | GO:0005525 | GTP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.