Protein Family IF08513
Metagenome
Isolate
194
Members
72
Samples
180
Scaffolds
169.01
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_129641|Ga0466729_129641_8208_8792
- Length
- 194 aa
- Sequence
- LEDKLAEQILKQNNDERASHSRPAKGTRGEQGFKPRVDDGLIETVVAVNRVAKVVKGGKRFSFSALVVKGDGAGKVGCGLGKAKEVQAAIQKGALQAAKHLISVKLKDTTIPHEIIGVSGAGKVLLKPAAHGTGVIAGGSVRAVLEAVGIKDILTKSMRSSNPFNVVYATIEALKLLRTKEDVAQIRNKEVTEI
Sample Types
Isolate
7.2%
Metagenome
92.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.2%
Unclassified
20.3%
Kalotermitidae
20.3%
Formicidae
7.2%
Armadillidiidae
5.8%
Termopsidae
5.8%
Rhinotermitidae
5.8%
Culicidae
4.3%
Passalidae
1.4%
Elmidae
1.4%
Drosophilidae
1.4%
Hydrophilidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
185
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 3 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 4 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 5 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 6 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 13 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300007088 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut | Metagenome | Drosophilidae |
| 20 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 21 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 22 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 34 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 37 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 38 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 39 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 40 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 41 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 42 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 45 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 46 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 50 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 51 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 52 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 59 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 60 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 61 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 62 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 63 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 66 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 67 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 68 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 69 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 70 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 71 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 72 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_083031 | 3300042612 | Bacteria | 54035 |
| 2 | Ga0160456_100416 | 3300012820 | Bacteria | 14373 |
| 3 | Ga0160469_101767 | 3300012824 | Unclassified | 5083 |
| 4 | Ga0160472_101326 | 3300012839 | Bacteria | 7578 |
| 5 | Ga0466657_213949 | 3300042582 | Bacteria | 1366 |
| 6 | Ga0466690_227494 | 3300042590 | Bacteria | 19382 |
| 7 | Ga0466713_059453 | 3300042602 | Bacteria | 25190 |
| 8 | Ga0466716_030547 | 3300042605 | Unclassified | 4072 |
| 9 | Ga0466719_130653 | 3300042606 | Bacteria | 158630 |
| 10 | Ga0466722_242371 | 3300042609 | Bacteria | 3413 |
| 11 | Ga0123356_10139456 | 3300010049 | Bacteria | 2390 |
| 12 | Ga0068305_10268440 | 3300005083 | Bacteria | 791 |
| 13 | Ga0466734_107201 | 3300042623 | Unclassified | 1842 |
| 14 | Ga0466735_008299 | 3300042624 | Bacteria | 6183 |
| 15 | Ga0466735_201674 | 3300042624 | Bacteria | 26620 |
| 16 | Ga0466711_439564 | 3300042615 | Bacteria | 4556 |
| 17 | Ga0466715_256894 | 3300042616 | Bacteria | 26066 |
| 18 | Ga0466723_128569 | 3300042618 | Bacteria | 22727 |
| 19 | Ga0466726_242160 | 3300042619 | Bacteria | 13880 |
| 20 | Ga0466726_303540 | 3300042619 | Bacteria | 65545 |
| 21 | Ga0466726_387678 | 3300042619 | Bacteria | 397429 |
| 22 | Ga0466726_405211 | 3300042619 | Bacteria | 2833 |
| 23 | Ga0466728_407609 | 3300042620 | Bacteria | 161023 |
| 24 | Ga0466729_117205 | 3300042621 | Bacteria | 50557 |
| 25 | Ga0160440_100345 | 3300012815 | Bacteria | 20640 |
| 26 | Ga0160436_1000158 | 3300012861 | Bacteria | 34161 |
| 27 | Ga0160436_1011091 | 3300012861 | Bacteria | 1938 |
| 28 | Ga0466706_037575 | 3300042599 | Bacteria | 87054 |
| 29 | Ga0466707_063131 | 3300042601 | Bacteria | 29958 |
| 30 | Ga0466713_104587 | 3300042602 | Bacteria | 60209 |
| 31 | Ga0466722_086030 | 3300042609 | Bacteria | 5720 |
| 32 | Ga0102734_1000029 | 3300007129 | Bacteria | 68380 |
| 33 | Ga0102738_1000060 | 3300007141 | Bacteria | 45614 |
| 34 | Ga0466735_116185 | 3300042624 | Bacteria | 24593 |
| 35 | Ga0466735_164481 | 3300042624 | Bacteria | 11213 |
| 36 | Ga0466735_218123 | 3300042624 | Bacteria | 14066 |
| 37 | Ga0466704_254590 | 3300042643 | Bacteria | 26552 |
| 38 | Ga0466708_396767 | 3300042652 | Bacteria | 2241 |
| 39 | Ga0466727_059455 | 3300042655 | Bacteria | 175715 |
| 40 | Ga0466711_134125 | 3300042615 | Bacteria | 100014 |
| 41 | Ga0466715_402109 | 3300042616 | Bacteria | 22027 |
| 42 | Ga0466715_544001 | 3300042616 | Bacteria | 3837 |
| 43 | Ga0466723_180228 | 3300042618 | Bacteria | 22722 |
| 44 | Ga0466728_355312 | 3300042620 | Bacteria | 41370 |
| 45 | Ga0466729_026885 | 3300042621 | Bacteria | 13644 |
| 46 | Ga0466705_365823 | 3300042612 | Bacteria | 22090 |
| 47 | Ga0466656_371289 | 3300042550 | Unclassified | 1031 |
| 48 | Ga0466690_193255 | 3300042590 | Bacteria | 4634 |
| 49 | Ga0466696_173896 | 3300042596 | Unclassified | 2032 |
| 50 | Ga0466699_355647 | 3300042597 | Bacteria | 1487 |
| 51 | Ga0466713_052484 | 3300042602 | Bacteria | 51192 |
| 52 | Ga0466719_345206 | 3300042606 | Bacteria | 3632 |
| 53 | Ga0123357_10004444 | 3300009784 | Bacteria | 16465 |
| 54 | Ga0123357_10006163 | 3300009784 | Bacteria | 14543 |
| 55 | Ga0123355_10073553 | 3300009826 | Bacteria | 5477 |
| 56 | Ga0104047_1120976 | 3300007088 | Unclassified | 1308 |
| 57 | Ga0103260_1000020 | 3300007139 | Bacteria | 70191 |
| 58 | Ga0466729_216896 | 3300042621 | Bacteria | 3709 |
| 59 | Ga0466730_003319 | 3300042625 | Bacteria | 15502 |
| 60 | Ga0466704_177682 | 3300042643 | Bacteria | 28567 |
| 61 | Ga0466705_144704 | 3300042612 | Bacteria | 26960 |
| 62 | Ga0160457_1000003 | 3300012858 | Bacteria | 1020748 |
| 63 | Ga0466716_126380 | 3300042605 | Bacteria | 28858 |
| 64 | Ga0466719_492562 | 3300042606 | Bacteria | 22587 |
| 65 | Ga0466722_188234 | 3300042609 | Bacteria | 7645 |
| 66 | Ga0123354_10546465 | 3300010882 | Bacteria | 876 |
| 67 | Ga0466734_076859 | 3300042623 | Bacteria | 25073 |
| 68 | Ga0466735_050544 | 3300042624 | Bacteria | 5700 |
| 69 | Ga0466703_110964 | 3300042636 | Bacteria | 165564 |
| 70 | Ga0466727_050462 | 3300042655 | Bacteria | 20965 |
| 71 | Ga0466710_029427 | 3300042613 | Bacteria | 4120 |
| 72 | Ga0466723_051817 | 3300042618 | Bacteria | 7638 |
| 73 | Ga0466726_077377 | 3300042619 | Bacteria | 33283 |
| 74 | Ga0466726_159510 | 3300042619 | Bacteria | 1272 |
| 75 | Ga0466728_151666 | 3300042620 | Bacteria | 23701 |
| 76 | Ga0466705_068331 | 3300042612 | Bacteria | 4360 |
| 77 | Ga0466705_108167 | 3300042612 | Bacteria | 5567 |
| 78 | Ga0466705_208486 | 3300042612 | Bacteria | 71494 |
| 79 | Ga0466705_211457 | 3300042612 | Bacteria | 22546 |
| 80 | Ga0466657_203405 | 3300042582 | Bacteria | 6735 |
| 81 | Ga0466690_029087 | 3300042590 | Bacteria | 68822 |
| 82 | Ga0466706_050675 | 3300042599 | Bacteria | 29028 |
| 83 | Ga0466706_217033 | 3300042599 | Bacteria | 132615 |
| 84 | Ga0466707_315151 | 3300042601 | Bacteria | 79442 |
| 85 | Ga0466714_088412 | 3300042603 | Bacteria | 38937 |
| 86 | Ga0466716_120013 | 3300042605 | Bacteria | 4056 |
| 87 | Ga0466722_000144 | 3300042609 | Bacteria | 10208 |
| 88 | Ga0123357_10260144 | 3300009784 | Bacteria | 1836 |
| 89 | Ga0123356_10277786 | 3300010049 | Unclassified | 1768 |
| 90 | Ga0466735_017558 | 3300042624 | Bacteria | 5430 |
| 91 | Ga0466703_220297 | 3300042636 | Bacteria | 23837 |
| 92 | Ga0466727_134101 | 3300042655 | Bacteria | 2880 |
| 93 | Ga0466715_158630 | 3300042616 | Bacteria | 22211 |
| 94 | Ga0466715_303169 | 3300042616 | Bacteria | 1599 |
| 95 | Ga0466723_045349 | 3300042618 | Bacteria | 1575 |
| 96 | Ga0466723_091919 | 3300042618 | Bacteria | 27263 |
| 97 | Ga0466728_411352 | 3300042620 | Bacteria | 26274 |
| 98 | Ga0466729_053911 | 3300042621 | Bacteria | 4809 |
| 99 | Ga0466729_129641 | 3300042621 | Bacteria | 24606 |
| 100 | Ga0466729_162352 | 3300042621 | Bacteria | 4842 |
| 101 | Ga0160468_103532 | 3300012819 | Bacteria | 2111 |
| 102 | Ga0466656_111845 | 3300042550 | Unclassified | 2238 |
| 103 | Ga0466657_163679 | 3300042582 | Bacteria | 4487 |
| 104 | Ga0466692_045540 | 3300042591 | Bacteria | 1573 |
| 105 | Ga0466691_226264 | 3300042593 | Bacteria | 41880 |
| 106 | Ga0466706_077393 | 3300042599 | Bacteria | 4735 |
| 107 | Ga0466700_070972 | 3300042600 | Bacteria | 5428 |
| 108 | Ga0466707_012192 | 3300042601 | Bacteria | 7479 |
| 109 | Ga0466713_092327 | 3300042602 | Bacteria | 48279 |
| 110 | Ga0466698_145828 | 3300042610 | Bacteria | 6446 |
| 111 | Ga0123356_10000157 | 3300010049 | Bacteria | 76908 |
| 112 | Ga0160454_100452 | 3300012798 | Bacteria | 17001 |
| 113 | 2227476289 | 2225789004 | Bacteria | 4633 |
| 114 | Ga0068302_10117181 | 3300005071 | Unclassified | 2360 |
| 115 | Ga0466735_070774 | 3300042624 | Bacteria | 15100 |
| 116 | Ga0466704_591830 | 3300042643 | Bacteria | 37928 |
| 117 | Ga0466708_370222 | 3300042652 | Bacteria | 10991 |
| 118 | Ga0466727_322139 | 3300042655 | Bacteria | 101886 |
| 119 | Ga0466711_372501 | 3300042615 | Bacteria | 489210 |
| 120 | Ga0466711_376431 | 3300042615 | Bacteria | 48940 |
| 121 | Ga0466715_046636 | 3300042616 | Bacteria | 70768 |
| 122 | Ga0466715_472941 | 3300042616 | Bacteria | 17840 |
| 123 | Ga0466723_053195 | 3300042618 | Bacteria | 11447 |
| 124 | Ga0466726_487910 | 3300042619 | Bacteria | 2806 |
| 125 | Ga0160457_1000004 | 3300012858 | Bacteria | 638897 |
| 126 | Ga0466690_262559 | 3300042590 | Bacteria | 16410 |
| 127 | Ga0466706_016612 | 3300042599 | Bacteria | 25546 |
| 128 | Ga0466706_166478 | 3300042599 | Bacteria | 103376 |
| 129 | Ga0466707_344831 | 3300042601 | Bacteria | 1868 |
| 130 | Ga0123355_10026940 | 3300009826 | Bacteria | 9279 |
| 131 | JGI24705J35276_12238808 | 3300002504 | Bacteria | 121301 |
| 132 | Ga0068302_10000447 | 3300005071 | Bacteria | 13341 |
| 133 | Ga0068302_10001564 | 3300005071 | Bacteria | 20938 |
| 134 | Ga0068302_10056163 | 3300005071 | Bacteria | 8349 |
| 135 | Ga0068305_10000775 | 3300005083 | Bacteria | 12637 |
| 136 | Ga0102736_1000002 | 3300007052 | Bacteria | 204958 |
| 137 | Ga0102737_1000003 | 3300007142 | Bacteria | 215134 |
| 138 | Ga0466729_273866 | 3300042621 | Bacteria | 10682 |
| 139 | Ga0466735_053051 | 3300042624 | Bacteria | 11352 |
| 140 | Ga0466735_135304 | 3300042624 | Bacteria | 3460 |
| 141 | Ga0466735_172430 | 3300042624 | Bacteria | 13043 |
| 142 | Ga0466704_375586 | 3300042643 | Bacteria | 37503 |
| 143 | Ga0466727_214209 | 3300042655 | Bacteria | 66628 |
| 144 | Ga0466711_291676 | 3300042615 | Bacteria | 12670 |
| 145 | Ga0466711_427370 | 3300042615 | Bacteria | 90157 |
| 146 | Ga0466726_156284 | 3300042619 | Bacteria | 3756 |
| 147 | Ga0466726_172880 | 3300042619 | Bacteria | 24710 |
| 148 | Ga0160448_102793 | 3300012854 | Bacteria | 5279 |
| 149 | Ga0456237_0011935 | 3300041968 | Bacteria | 1263 |
| 150 | Ga0466690_230957 | 3300042590 | Bacteria | 25729 |
| 151 | Ga0466692_185390 | 3300042591 | Bacteria | 2965 |
| 152 | Ga0466694_034117 | 3300042594 | Bacteria | 3884 |
| 153 | Ga0466696_034494 | 3300042596 | Bacteria | 1972 |
| 154 | Ga0466701_025535 | 3300042598 | Bacteria | 249043 |
| 155 | Ga0466706_213897 | 3300042599 | Bacteria | 18237 |
| 156 | Ga0466706_238270 | 3300042599 | Bacteria | 1571 |
| 157 | Ga0466707_151294 | 3300042601 | Bacteria | 6212 |
| 158 | Ga0466707_419824 | 3300042601 | Bacteria | 10793 |
| 159 | Ga0466716_454581 | 3300042605 | Bacteria | 19893 |
| 160 | Ga0466719_048950 | 3300042606 | Bacteria | 50096 |
| 161 | Ga0466719_340860 | 3300042606 | Bacteria | 2065 |
| 162 | Ga0466719_480821 | 3300042606 | Bacteria | 7291 |
| 163 | Ga0123354_10083619 | 3300010882 | Bacteria | 4489 |
| 164 | Ga0068305_10001287 | 3300005083 | Bacteria | 40663 |
| 165 | Ga0068305_10001382 | 3300005083 | Bacteria | 35132 |
| 166 | Ga0068305_10005361 | 3300005083 | Bacteria | 24001 |
| 167 | Ga0466735_027818 | 3300042624 | Bacteria | 7551 |
| 168 | Ga0466735_033778 | 3300042624 | Bacteria | 18285 |
| 169 | Ga0466735_068093 | 3300042624 | Bacteria | 16099 |
| 170 | Ga0466735_176248 | 3300042624 | Bacteria | 15805 |
| 171 | Ga0466703_094842 | 3300042636 | Bacteria | 32537 |
| 172 | Ga0466704_022207 | 3300042643 | Bacteria | 18398 |
| 173 | Ga0466704_144247 | 3300042643 | Bacteria | 4176 |
| 174 | Ga0466704_410836 | 3300042643 | Bacteria | 5241 |
| 175 | Ga0466709_233182 | 3300042648 | Bacteria | 91749 |
| 176 | Ga0466727_271147 | 3300042655 | Bacteria | 176023 |
| 177 | Ga0466715_258610 | 3300042616 | Bacteria | 21204 |
| 178 | Ga0466715_436492 | 3300042616 | Bacteria | 169505 |
| 179 | Ga0466723_085453 | 3300042618 | Bacteria | 73497 |
| 180 | Ga0466726_020553 | 3300042619 | Bacteria | 11602 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.