Protein Family IF08435
Metagenome
Isolate
133
Members
50
Samples
129
Scaffolds
288.69
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_233112|Ga0466728_233112_3904_4860
- Length
- 318 aa
- Sequence
- VKKNLYRKEAGKMAKKKKLRVYGSHLESIIFNTVNTIFLLLFSMIMLYPILNMLAISFNNGIDTVRGGIHLWPRQFTLKNYQTILTSNTIGMAFLNSVTKTVIAVVTNVVFTAMLAYTISRKEYVLRKFVSIMFVLTMYFSAGLIPTYMLMKNLHLINSYHVYWVPGILSAFNIIVIRTFIRGLPESLVESAKADGAGEFRIFWSIIFPLCMPALATIALFVAVGSWNSWFDTFIYNSSNPRLSTLQYELQKLLSSAMNSNSNQNIASVSTEQAQSLQVTPTSIRAAITIFTALPILMVYPFLQRYFVTGLTLGGVKE
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Kalotermitidae
27.1%
Unclassified
10.4%
Rhinotermitidae
8.3%
Passalidae
6.2%
Termopsidae
4.2%
Scarabaeidae
4.2%
Tenebrionidae
2.1%
Hodotermitidae
2.1%
Armadillidiidae
2.1%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 3 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 4 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 5 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 6 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 10 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 19 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 20 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 21 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 22 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 23 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 34 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 35 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 36 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 37 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 38 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 44 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 45 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 46 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 47 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 48 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 49 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 50 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123355_10135490 | 3300009826 | Bacteria | 3783 |
| 2 | Ga0123355_10410020 | 3300009826 | Bacteria | 1740 |
| 3 | Ga0123353_10088463 | 3300010167 | Bacteria | 4988 |
| 4 | Ga0466719_534330 | 3300042606 | Bacteria | 8410 |
| 5 | Ga0466720_031937 | 3300042607 | Bacteria | 1842 |
| 6 | Ga0415639_146969 | 3300038395 | Bacteria | 6040 |
| 7 | Ga0466690_390400 | 3300042590 | Bacteria | 5967 |
| 8 | Ga0466729_236124 | 3300042621 | Bacteria | 3928 |
| 9 | Ga0466724_63634 | 3300042649 | Bacteria | 2344 |
| 10 | Ga0466708_181368 | 3300042652 | Bacteria | 8432 |
| 11 | Ga0466727_174742 | 3300042655 | Bacteria | 12328 |
| 12 | IMNBL1DRAFT_c0000023 | 3300000062 | Bacteria | 146871 |
| 13 | IMNBL1DRAFT_c0000031 | 3300000062 | Bacteria | 127090 |
| 14 | Ga0466705_394558 | 3300042612 | Bacteria | 8248 |
| 15 | Ga0466726_171240 | 3300042619 | Bacteria | 11537 |
| 16 | Ga0466728_360851 | 3300042620 | Bacteria | 5164 |
| 17 | Ga0466729_174920 | 3300042621 | Bacteria | 3068 |
| 18 | Ga0562376_1301 | 3300056857 | Bacteria | 35872 |
| 19 | Ga0123355_10639931 | 3300009826 | Bacteria | 1245 |
| 20 | Ga0466714_010173 | 3300042603 | Bacteria | 58829 |
| 21 | Ga0466716_409358 | 3300042605 | Unclassified | 5083 |
| 22 | Ga0466690_029508 | 3300042590 | Bacteria | 3281 |
| 23 | Ga0466692_026876 | 3300042591 | Unclassified | 5195 |
| 24 | Ga0466693_248258 | 3300042592 | Bacteria | 1512 |
| 25 | Ga0466694_035571 | 3300042594 | Bacteria | 12646 |
| 26 | Ga0466702_396461 | 3300042635 | Bacteria | 1559 |
| 27 | Ga0466709_095518 | 3300042648 | Bacteria | 2378 |
| 28 | Ga0466709_376552 | 3300042648 | Bacteria | 26434 |
| 29 | Ga0466708_002619 | 3300042652 | Bacteria | 11795 |
| 30 | Ga0466708_199190 | 3300042652 | Bacteria | 13660 |
| 31 | Ga0466727_081385 | 3300042655 | Bacteria | 3931 |
| 32 | Ga0072941_1020973 | 3300005201 | Bacteria | 68603 |
| 33 | Ga0466711_275009 | 3300042615 | Bacteria | 39101 |
| 34 | Ga0466723_360491 | 3300042618 | Unclassified | 3934 |
| 35 | Ga0466726_334386 | 3300042619 | Bacteria | 3636 |
| 36 | Ga0466728_221868 | 3300042620 | Bacteria | 5973 |
| 37 | Ga0123356_10007358 | 3300010049 | Bacteria | 10988 |
| 38 | Ga0466707_198657 | 3300042601 | Bacteria | 2695 |
| 39 | Ga0466714_066156 | 3300042603 | Bacteria | 1753 |
| 40 | Ga0466716_356783 | 3300042605 | Bacteria | 3306 |
| 41 | Ga0466722_021049 | 3300042609 | Bacteria | 6139 |
| 42 | Ga0466692_036110 | 3300042591 | Bacteria | 17917 |
| 43 | Ga0466699_249836 | 3300042597 | Bacteria | 1781 |
| 44 | Ga0466702_437673 | 3300042635 | Bacteria | 1939 |
| 45 | Ga0466703_130568 | 3300042636 | Bacteria | 23950 |
| 46 | Ga0466708_145340 | 3300042652 | Bacteria | 2165 |
| 47 | 2227071085 | 2225789003 | Unclassified | 2647 |
| 48 | Ga0466711_451724 | 3300042615 | Bacteria | 10804 |
| 49 | Ga0466728_233112 | 3300042620 | Bacteria | 10378 |
| 50 | Ga0123357_10358793 | 3300009784 | Bacteria | 1383 |
| 51 | Ga0123355_10002947 | 3300009826 | Bacteria | 24183 |
| 52 | Ga0466706_043622 | 3300042599 | Bacteria | 29874 |
| 53 | Ga0466719_395219 | 3300042606 | Bacteria | 1962 |
| 54 | Ga0466722_014994 | 3300042609 | Bacteria | 13199 |
| 55 | Ga0160445_102214 | 3300012847 | Bacteria | 4646 |
| 56 | Ga0466690_250427 | 3300042590 | Bacteria | 1475 |
| 57 | Ga0466691_174442 | 3300042593 | Bacteria | 4178 |
| 58 | Ga0466703_311649 | 3300042636 | Bacteria | 1053 |
| 59 | Ga0466704_603262 | 3300042643 | Unclassified | 4057 |
| 60 | Ga0466709_269913 | 3300042648 | Bacteria | 4762 |
| 61 | Ga0466709_271355 | 3300042648 | Bacteria | 4738 |
| 62 | Ga0466708_030056 | 3300042652 | Bacteria | 12802 |
| 63 | Ga0466708_101158 | 3300042652 | Bacteria | 4680 |
| 64 | Ga0123357_10055931 | 3300009784 | Bacteria | 5309 |
| 65 | Ga0123355_10133829 | 3300009826 | Bacteria | 3812 |
| 66 | Ga0466706_072834 | 3300042599 | Bacteria | 23733 |
| 67 | Ga0466706_108375 | 3300042599 | Bacteria | 2955 |
| 68 | Ga0466706_114772 | 3300042599 | Bacteria | 128005 |
| 69 | Ga0466700_227474 | 3300042600 | Bacteria | 4125 |
| 70 | Ga0466713_105856 | 3300042602 | Bacteria | 3586 |
| 71 | Ga0466714_040947 | 3300042603 | Bacteria | 14155 |
| 72 | Ga0466716_012214 | 3300042605 | Bacteria | 9687 |
| 73 | Ga0466719_253888 | 3300042606 | Bacteria | 6047 |
| 74 | Ga0466692_082591 | 3300042591 | Bacteria | 24841 |
| 75 | Ga0466694_134638 | 3300042594 | Bacteria | 58679 |
| 76 | Ga0466696_120574 | 3300042596 | Bacteria | 1722 |
| 77 | Ga0466709_089302 | 3300042648 | Unclassified | 2710 |
| 78 | Ga0466711_346574 | 3300042615 | Bacteria | 20390 |
| 79 | Ga0466726_476323 | 3300042619 | Bacteria | 1159 |
| 80 | Ga0466706_186430 | 3300042599 | Unclassified | 1588 |
| 81 | Ga0466714_009270 | 3300042603 | Unclassified | 1259 |
| 82 | Ga0466714_029084 | 3300042603 | Bacteria | 3950 |
| 83 | Ga0466714_086555 | 3300042603 | Unclassified | 2979 |
| 84 | Ga0466690_278675 | 3300042590 | Unclassified | 4594 |
| 85 | Ga0466696_318638 | 3300042596 | Unclassified | 3521 |
| 86 | Ga0466702_026661 | 3300042635 | Bacteria | 4525 |
| 87 | Ga0466702_148195 | 3300042635 | Bacteria | 6597 |
| 88 | Ga0466709_027107 | 3300042648 | Bacteria | 28864 |
| 89 | IMNBL1DRAFT_c0038515 | 3300000062 | Unclassified | 1643 |
| 90 | Ga0466711_214246 | 3300042615 | Bacteria | 1486 |
| 91 | Ga0466726_126690 | 3300042619 | Bacteria | 13592 |
| 92 | Ga0466728_154344 | 3300042620 | Bacteria | 4015 |
| 93 | Ga0123353_10749834 | 3300010167 | Bacteria | 1359 |
| 94 | Ga0466716_011165 | 3300042605 | Bacteria | 2452 |
| 95 | Ga0466719_067723 | 3300042606 | Bacteria | 22136 |
| 96 | Ga0466719_204055 | 3300042606 | Unclassified | 1419 |
| 97 | Ga0456237_0000470 | 3300041968 | Unclassified | 6122 |
| 98 | Ga0466690_093576 | 3300042590 | Bacteria | 4265 |
| 99 | Ga0466692_086036 | 3300042591 | Bacteria | 6534 |
| 100 | Ga0466731_393959 | 3300042622 | Bacteria | 2161 |
| 101 | Ga0466708_001693 | 3300042652 | Bacteria | 60643 |
| 102 | Ga0466708_160938 | 3300042652 | Bacteria | 18767 |
| 103 | Ga0466727_107060 | 3300042655 | Bacteria | 3500 |
| 104 | Ga0466711_314572 | 3300042615 | Bacteria | 1428 |
| 105 | Ga0466728_319217 | 3300042620 | Bacteria | 1440 |
| 106 | Ga0466705_291691 | 3300042612 | Bacteria | 3444 |
| 107 | Ga0466733_026128 | 3300042659 | Bacteria | 24277 |
| 108 | Ga0123355_10061967 | 3300009826 | Bacteria | 6038 |
| 109 | Ga0123356_10055465 | 3300010049 | Bacteria | 3691 |
| 110 | Ga0123353_10223843 | 3300010167 | Bacteria | 2939 |
| 111 | Ga0123353_10413162 | 3300010167 | Bacteria | 2003 |
| 112 | Ga0160466_100295 | 3300012809 | Bacteria | 31283 |
| 113 | Ga0466700_410712 | 3300042600 | Unclassified | 1333 |
| 114 | Ga0466714_092955 | 3300042603 | Unclassified | 2848 |
| 115 | Ga0466716_056133 | 3300042605 | Bacteria | 1778 |
| 116 | Ga0466716_092314 | 3300042605 | Bacteria | 7515 |
| 117 | Ga0466722_126579 | 3300042609 | Bacteria | 4601 |
| 118 | Ga0466690_033048 | 3300042590 | Bacteria | 9589 |
| 119 | Ga0466702_250377 | 3300042635 | Bacteria | 1309 |
| 120 | Ga0466703_061816 | 3300042636 | Bacteria | 6932 |
| 121 | 2227563530 | 2225789004 | Bacteria | 14306 |
| 122 | Ga0068305_10453644 | 3300005083 | Unclassified | 5743 |
| 123 | Ga0072941_1006638 | 3300005201 | Bacteria | 20983 |
| 124 | Ga0466712_223246 | 3300042614 | Bacteria | 13680 |
| 125 | Ga0466723_004254 | 3300042618 | Bacteria | 7474 |
| 126 | Ga0466723_167596 | 3300042618 | Bacteria | 8956 |
| 127 | Ga0466723_271028 | 3300042618 | Bacteria | 41313 |
| 128 | Ga0466726_060351 | 3300042619 | Bacteria | 4958 |
| 129 | Ga0466729_167148 | 3300042621 | Bacteria | 6422 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 129 | 308 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.