Protein Family IF08396

Metagenome Isolate
154 Members
94 Samples
122 Scaffolds
250.62 Avg Length

🧬 Representative Sequence

ID
3300042620|Ga0466728_083471|Ga0466728_083471_55104_55982
Length
292 aa
Sequence
MFKKINKSLLFYVKIPIYLVYFLDFYLSLLRKGNRMFPWFSKKEKKIDSEVKFEPEGKIPKHIAIIMDGNGRWASKRKLPRIAGHKEGMEAVKKVTTAASKLGVKVLTLYAFSTENWKRPDKEVKFLMKLPIDFFDHFVPELVKENVQVKTMGYVENLPAHTQDAVINAIEKTKDNTGMILNFALNYGGRAELLTTFQLLAKEVKNENLSPLDVSEEKVNDALMTGFLEKEFRDPELLIRTSGEERISNFLLWQLAYSEFYFTEELWPDFDGKSLKYAIAIFQKRNRRFGGL

📊 Sample Types

Isolate 20.8%
Metagenome 79.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 24.7%
Termitidae 23.6%
Kalotermitidae 12.4%
Formicidae 12.4%
Tenebrionidae 4.5%
Rhinotermitidae 4.5%
Termopsidae 4.5%
Passalidae 2.2%
Armadillidiidae 2.2%
Blattidae 2.2%
Drosophilidae 2.2%
Apidae 2.2%
Bombycidae 1.1%
Hodotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
2 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
3 2820921285 Unclassified Actinobacteria Emb289P3bin53 Isolate Unclassified
4 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
5 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
6 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
7 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
8 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
16 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
19 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
20 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
21 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
22 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
23 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
24 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
25 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
26 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
27 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
31 2603880173 Pseudomonas SP. Isolate Unclassified
32 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
33 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
34 2820476618 Unclassified Firmicutes Lab288P1bin80 Isolate Unclassified
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
37 8007223943 Enterococcus sp. MSG2901 Isolate
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
45 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
46 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
47 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
48 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
49 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
50 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
51 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
52 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
53 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
54 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
55 8108568626 Enterococcus sp. DIV1094 Isolate
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
61 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
62 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
63 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
64 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
65 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
66 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
67 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
68 2820010479 Unclassified Spirochaetes Th196P4bin55 Isolate Unclassified
69 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
70 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
71 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
72 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
73 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
74 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
75 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
76 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
77 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
78 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
79 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
80 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
81 2920168565 Paludibacter sp. 221 Isolate Blattidae
82 8114555646 Enterococcus sp. DIV1094 Isolate
83 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
84 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
85 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
86 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
87 2819998259 Unclassified Spirochaetes Nc150P4bin23 Isolate Unclassified
88 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
89 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
90 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
91 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
92 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
93 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
94 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466713_130567 3300042602 Bacteria 13992
2 Ga0562378_2199 3300056814 Unclassified 17208
3 Ga0123357_10085767 3300009784 Bacteria 4122
4 Ga0123355_10006233 3300009826 Bacteria 17621
5 Ga0123355_10021683 3300009826 Bacteria 10286
6 Ga0123353_10002414 3300010167 Bacteria 23221
7 Ga0123353_10011780 3300010167 Bacteria 12350
8 IMNBL1DRAFT_c0040190 3300000062 Bacteria 1586
9 JGI24702J35022_10004250 3300002462 Bacteria 8549
10 CVPL010W_10001425 3300002931 Bacteria 27970
11 Ga0103265_1000023 3300007068 Bacteria 32322
12 Ga0466726_149647 3300042619 Bacteria 8960
13 Ga0466706_263337 3300042599 Bacteria 3153
14 Ga0466722_033255 3300042609 Bacteria 1707
15 Ga0562378_0212 3300056814 Bacteria 138560
16 Ga0123355_10021478 3300009826 Bacteria 10332
17 Ga0123355_10385141 3300009826 Bacteria 1823
18 Ga0123353_10034707 3300010167 Bacteria 7879
19 JGI24695J34938_10000060 3300002450 Bacteria 89148
20 Ga0068302_10020860 3300005071 Bacteria 16866
21 Ga0072941_1017680 3300005201 Bacteria 99064
22 Ga0072941_1406125 3300005201 Bacteria 1562
23 Ga0102737_1003423 3300007142 Unclassified 3624
24 Ga0103264_1028691 3300007188 Unclassified 2597
25 Ga0255572_1002002 3300026175 Bacteria 18732
26 Ga0466693_176964 3300042592 Bacteria 2811
27 Ga0466696_067345 3300042596 Bacteria 4675
28 Ga0466710_442615 3300042613 Bacteria 1572
29 Ga0466723_097479 3300042618 Bacteria 24080
30 Ga0466726_057287 3300042619 Bacteria 8850
31 Ga0466728_083471 3300042620 Bacteria 56340
32 Ga0466709_330757 3300042648 Bacteria 15272
33 Ga0466727_294126 3300042655 Bacteria 6812
34 Ga0562379_0064 3300056790 Bacteria 452272
35 Ga0123355_10037586 3300009826 Bacteria 7873
36 JGI24695J34938_10000473 3300002450 Bacteria 38985
37 JGI24702J35022_10001795 3300002462 Bacteria 13233
38 CVPL005W_1000107 3300002934 Bacteria 34056
39 Ga0102739_1005126 3300007095 Bacteria 1811
40 Ga0466696_246206 3300042596 Bacteria 12912
41 Ga0466726_234364 3300042619 Bacteria 32912
42 Ga0466734_137802 3300042623 Bacteria 22603
43 Ga0466719_265532 3300042606 Bacteria 12717
44 Ga0562378_0159 3300056814 Bacteria 168994
45 Ga0562375_0009 3300056856 Bacteria 1746158
46 Ga0123353_10220824 3300010167 Bacteria 2963
47 HBC_ctgsDRAFT_1000025 3300000333 Bacteria 37953
48 Ga0103266_1000007 3300007067 Bacteria 130661
49 Ga0160433_100144 3300012846 Bacteria 62485
50 Ga0466657_195928 3300042582 Bacteria 6358
51 Ga0466691_157204 3300042593 Bacteria 33688
52 Ga0466696_295642 3300042596 Bacteria 9835
53 Ga0466699_357355 3300042597 Bacteria 1354
54 Ga0466711_398117 3300042615 Bacteria 15142
55 Ga0466734_084436 3300042623 Bacteria 2436
56 Ga0466725_077079 3300042654 Bacteria 31530
57 Ga0466706_103297 3300042599 Bacteria 2637
58 Ga0466706_213436 3300042599 Bacteria 7006
59 Ga0466722_133429 3300042609 Bacteria 12238
60 Ga0466698_002867 3300042610 Bacteria 1775
61 Ga0562379_4041 3300056790 Bacteria 8277
62 Ga0123355_10203815 3300009826 Unclassified 2883
63 IMNBL1DRAFT_c0018074 3300000062 Bacteria 2942
64 JGI24702J35022_10163501 3300002462 Bacteria 1255
65 JGI24696J40584_12873947 3300002834 Bacteria 1056
66 Ga0068302_10045277 3300005071 Bacteria 6769
67 Ga0102736_1003179 3300007052 Unclassified 5021
68 Ga0103267_1000677 3300007190 Bacteria 20299
69 Ga0466657_316048 3300042582 Bacteria 12805
70 Ga0466692_023483 3300042591 Bacteria 16465
71 Ga0466715_262837 3300042616 Bacteria 26057
72 Ga0466729_282476 3300042621 Bacteria 10369
73 Ga0466731_260835 3300042622 Bacteria 1202
74 Ga0466727_332161 3300042655 Bacteria 6469
75 Ga0466719_466443 3300042606 Bacteria 8952
76 Ga0466698_479961 3300042610 Bacteria 1423
77 Ga0466733_217385 3300042659 Bacteria 25662
78 Ga0562379_0049 3300056790 Bacteria 522222
79 Ga0123355_10012631 3300009826 Bacteria 13092
80 Ga0123355_10371952 3300009826 Bacteria 1871
81 Ga0123353_10155822 3300010167 Bacteria 3641
82 JGI24702J35022_10005031 3300002462 Bacteria 7786
83 JGI24702J35022_10012338 3300002462 Unclassified 4753
84 JGI24702J35022_10126763 3300002462 Bacteria 1414
85 Ga0102739_1000071 3300007095 Bacteria 31158
86 Ga0103264_1017199 3300007188 Bacteria 3538
87 Ga0466715_464220 3300042616 Unclassified 4402
88 Ga0466735_233356 3300042624 Bacteria 2189
89 Ga0466724_06008 3300042649 Bacteria 1220
90 Ga0466725_142165 3300042654 Bacteria 12020
91 Ga0466727_034401 3300042655 Bacteria 27774
92 Ga0466697_126925 3300042611 Bacteria 1336
93 Ga0466719_350716 3300042606 Bacteria 4488
94 Ga0466697_031221 3300042611 Bacteria 1614
95 Ga0562378_0030 3300056814 Bacteria 540869
96 Ga0123353_10067941 3300010167 Bacteria 5723
97 Ga0123353_10215113 3300010167 Bacteria 3011
98 2227577403 2225789004 Bacteria 13551
99 JGI24703J35330_11744667 3300002501 Bacteria 4262
100 JGI24703J35330_11748186 3300002501 Bacteria 11718
101 Ga0103264_1000462 3300007188 Bacteria 27826
102 Ga0103264_1000489 3300007188 Bacteria 22136
103 Ga0103268_1000002 3300007192 Bacteria 107289
104 Ga0160468_100098 3300012819 Bacteria 101080
105 Ga0466690_266154 3300042590 Bacteria 16703
106 Ga0466696_306630 3300042596 Bacteria 3241
107 Ga0466710_126556 3300042613 Bacteria 3726
108 Ga0466703_007779 3300042636 Bacteria 9718
109 Ga0466725_015802 3300042654 Bacteria 8731
110 Ga0466707_271840 3300042601 Bacteria 8118
111 Ga0466714_028666 3300042603 Bacteria 89946
112 Ga0562374_1398 3300057007 Bacteria 28476
113 Ga0123355_10008773 3300009826 Bacteria 15295
114 Ga0123355_10040422 3300009826 Bacteria 7590
115 Ga0123355_10202083 3300009826 Bacteria 2900
116 Ga0123353_10429471 3300010167 Bacteria 1954
117 2227133584 2225789004 Bacteria 8876
118 Ga0068302_10005196 3300005071 Bacteria 15357
119 Ga0466656_362369 3300042550 Bacteria 4034
120 Ga0466715_181761 3300042616 Bacteria 4137
121 Ga0466704_088677 3300042643 Bacteria 8921
122 Ga0466725_464824 3300042654 Bacteria 28639

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01255 Prenyltransf Putative undecaprenyl diphosphate synthase 66 290 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01255 GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.