Protein Family IF08368
Metagenome
Isolate
155
Members
58
Samples
138
Scaffolds
276.9
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_486560|Ga0466726_486560_662_1558
- Length
- 298 aa
- Sequence
- MNPTVLDLKFFQDKAPFFKTRLGTWFLKKLFHWAEINKVNEIHGKYCHLRGSAFTSAMLADPLMNVNYNIHNKEILDTLPKGAFITVSNHPIGSLDGIILIDIFAKLRPDFKVMVNEILAHISAMGDNFISVIPHTGENQDPNKQNVNGIRLSLGQLLNGHPMGFFPAGAVSFYNKTLHQVRDLTWAHSVIRLIRKAAVPIYPVYFDFLNTKVFYRWGRISWKLRLLRVAKEAFNKQGQTLDVYLGQPITPEIIGNISDDNELADFLYNATYWSLNSKKVKEKDIIKKNFLNIYNMIF
Sample Types
Isolate
11.0%
Metagenome
89.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
30.4%
Kalotermitidae
25.0%
Termitidae
19.6%
Termopsidae
7.1%
Unclassified
5.4%
Rhinotermitidae
5.4%
Passalidae
5.4%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 4 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 25 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 26 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 27 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 35 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 36 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 37 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 38 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 39 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 40 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 41 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 42 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 48 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 49 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 50 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 53 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 54 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 55 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 56 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 57 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_128678 | 3300042600 | Bacteria | 4925 |
| 2 | JGI24702J35022_10000173 | 3300002462 | Bacteria | 33823 |
| 3 | Ga0068305_10097552 | 3300005083 | Bacteria | 14521 |
| 4 | Ga0466705_111607 | 3300042612 | Bacteria | 1258 |
| 5 | Ga0466735_086839 | 3300042624 | Bacteria | 1500 |
| 6 | Ga0466703_148815 | 3300042636 | Bacteria | 16579 |
| 7 | Ga0466703_232598 | 3300042636 | Bacteria | 11554 |
| 8 | Ga0466703_250134 | 3300042636 | Bacteria | 18299 |
| 9 | Ga0466704_094066 | 3300042643 | Bacteria | 24442 |
| 10 | Ga0466709_004107 | 3300042648 | Bacteria | 9539 |
| 11 | Ga0466727_316724 | 3300042655 | Bacteria | 6701 |
| 12 | Ga0466711_075194 | 3300042615 | Bacteria | 13386 |
| 13 | Ga0466715_286957 | 3300042616 | Bacteria | 6283 |
| 14 | Ga0466723_049242 | 3300042618 | Bacteria | 72461 |
| 15 | Ga0466728_016383 | 3300042620 | Bacteria | 48703 |
| 16 | Ga0466707_417139 | 3300042601 | Bacteria | 1343 |
| 17 | Ga0466713_131527 | 3300042602 | Bacteria | 55397 |
| 18 | Ga0466714_029794 | 3300042603 | Bacteria | 42861 |
| 19 | Ga0466716_340066 | 3300042605 | Bacteria | 22650 |
| 20 | Ga0466696_059060 | 3300042596 | Bacteria | 8993 |
| 21 | Ga0466703_004639 | 3300042636 | Bacteria | 9442 |
| 22 | Ga0466703_043658 | 3300042636 | Bacteria | 3317 |
| 23 | Ga0466727_202107 | 3300042655 | Bacteria | 7371 |
| 24 | Ga0466711_009294 | 3300042615 | Bacteria | 6431 |
| 25 | Ga0466723_165155 | 3300042618 | Bacteria | 30063 |
| 26 | Ga0466728_313391 | 3300042620 | Bacteria | 9508 |
| 27 | Ga0466707_360201 | 3300042601 | Bacteria | 12907 |
| 28 | Ga0466719_229549 | 3300042606 | Bacteria | 20920 |
| 29 | Ga0466722_178845 | 3300042609 | Bacteria | 79493 |
| 30 | Ga0466697_005831 | 3300042611 | Bacteria | 1912 |
| 31 | Ga0466696_117970 | 3300042596 | Bacteria | 23257 |
| 32 | Ga0068305_10001970 | 3300005083 | Bacteria | 23230 |
| 33 | Ga0068305_10011097 | 3300005083 | Bacteria | 15891 |
| 34 | Ga0466735_074304 | 3300042624 | Bacteria | 1890 |
| 35 | Ga0466702_459107 | 3300042635 | Bacteria | 1306 |
| 36 | Ga0466703_028432 | 3300042636 | Bacteria | 36646 |
| 37 | Ga0466704_062557 | 3300042643 | Bacteria | 13240 |
| 38 | Ga0466704_345357 | 3300042643 | Bacteria | 5171 |
| 39 | Ga0466709_170961 | 3300042648 | Bacteria | 6157 |
| 40 | Ga0466708_060683 | 3300042652 | Bacteria | 49198 |
| 41 | Ga0466708_367106 | 3300042652 | Bacteria | 72455 |
| 42 | Ga0466727_057671 | 3300042655 | Bacteria | 13388 |
| 43 | Ga0466710_436157 | 3300042613 | Bacteria | 1224 |
| 44 | Ga0466711_036637 | 3300042615 | Bacteria | 5511 |
| 45 | Ga0466715_193888 | 3300042616 | Bacteria | 87863 |
| 46 | Ga0466723_236425 | 3300042618 | Bacteria | 5358 |
| 47 | Ga0466726_162992 | 3300042619 | Bacteria | 3597 |
| 48 | Ga0466726_305190 | 3300042619 | Bacteria | 6378 |
| 49 | Ga0466726_485037 | 3300042619 | Bacteria | 18142 |
| 50 | Ga0466707_022637 | 3300042601 | Bacteria | 11587 |
| 51 | Ga0466707_341657 | 3300042601 | Bacteria | 2481 |
| 52 | Ga0466716_351854 | 3300042605 | Bacteria | 31697 |
| 53 | Ga0466656_235642 | 3300042550 | Bacteria | 2554 |
| 54 | Ga0466657_322362 | 3300042582 | Bacteria | 1617 |
| 55 | Ga0466692_179942 | 3300042591 | Bacteria | 100786 |
| 56 | Ga0068305_10027778 | 3300005083 | Bacteria | 27344 |
| 57 | Ga0466705_100030 | 3300042612 | Bacteria | 8932 |
| 58 | Ga0466705_174208 | 3300042612 | Bacteria | 28798 |
| 59 | Ga0466735_191480 | 3300042624 | Bacteria | 1793 |
| 60 | Ga0466703_182428 | 3300042636 | Bacteria | 6795 |
| 61 | Ga0466703_233285 | 3300042636 | Bacteria | 5534 |
| 62 | Ga0466704_073764 | 3300042643 | Bacteria | 58999 |
| 63 | Ga0466704_116828 | 3300042643 | Bacteria | 10950 |
| 64 | Ga0466711_199823 | 3300042615 | Bacteria | 7379 |
| 65 | Ga0466722_245435 | 3300042609 | Bacteria | 23596 |
| 66 | Ga0265387_1008606 | 3300024582 | Bacteria | 1373 |
| 67 | 2227447479 | 2225789004 | Bacteria | 5436 |
| 68 | 2227447485 | 2225789004 | Bacteria | 5434 |
| 69 | JGI24705J35276_12238107 | 3300002504 | Bacteria | 15966 |
| 70 | Ga0068305_10031167 | 3300005083 | Bacteria | 9795 |
| 71 | Ga0072941_1508486 | 3300005201 | Unclassified | 1521 |
| 72 | Ga0466729_220506 | 3300042621 | Bacteria | 4187 |
| 73 | Ga0466704_137344 | 3300042643 | Bacteria | 13243 |
| 74 | Ga0466708_014247 | 3300042652 | Bacteria | 21773 |
| 75 | Ga0466705_472001 | 3300042612 | Bacteria | 3397 |
| 76 | Ga0466723_070186 | 3300042618 | Bacteria | 30269 |
| 77 | Ga0466726_486560 | 3300042619 | Bacteria | 2123 |
| 78 | Ga0466719_051334 | 3300042606 | Bacteria | 11558 |
| 79 | Ga0466690_113175 | 3300042590 | Bacteria | 17999 |
| 80 | Ga0466690_185291 | 3300042590 | Bacteria | 4002 |
| 81 | Ga0466690_245129 | 3300042590 | Bacteria | 16092 |
| 82 | Ga0466690_396116 | 3300042590 | Bacteria | 22996 |
| 83 | Ga0466692_205471 | 3300042591 | Bacteria | 27218 |
| 84 | Ga0466691_017347 | 3300042593 | Bacteria | 27633 |
| 85 | Ga0466696_015606 | 3300042596 | Bacteria | 14692 |
| 86 | Ga0466696_217627 | 3300042596 | Bacteria | 13048 |
| 87 | Ga0466696_341247 | 3300042596 | Bacteria | 22034 |
| 88 | JGI24702J35022_10048175 | 3300002462 | Bacteria | 2269 |
| 89 | JGI24702J35022_10131760 | 3300002462 | Bacteria | 1388 |
| 90 | Ga0068302_10032364 | 3300005071 | Unclassified | 3339 |
| 91 | Ga0068305_10305730 | 3300005083 | Bacteria | 3872 |
| 92 | Ga0466705_156547 | 3300042612 | Bacteria | 6617 |
| 93 | Ga0466704_170204 | 3300042643 | Bacteria | 3918 |
| 94 | Ga0466704_491253 | 3300042643 | Bacteria | 4056 |
| 95 | Ga0466727_138028 | 3300042655 | Bacteria | 18367 |
| 96 | Ga0466727_201028 | 3300042655 | Bacteria | 11677 |
| 97 | Ga0466710_432784 | 3300042613 | Bacteria | 1388 |
| 98 | Ga0466715_083069 | 3300042616 | Bacteria | 26157 |
| 99 | Ga0466715_128636 | 3300042616 | Bacteria | 28523 |
| 100 | Ga0466715_482123 | 3300042616 | Bacteria | 15683 |
| 101 | Ga0466726_024289 | 3300042619 | Bacteria | 9047 |
| 102 | Ga0466733_096868 | 3300042659 | Bacteria | 74750 |
| 103 | Ga0466719_158873 | 3300042606 | Bacteria | 5768 |
| 104 | Ga0466722_014160 | 3300042609 | Bacteria | 11613 |
| 105 | Ga0466690_072790 | 3300042590 | Bacteria | 21646 |
| 106 | Ga0466690_276324 | 3300042590 | Bacteria | 2066 |
| 107 | Ga0466690_375807 | 3300042590 | Bacteria | 12353 |
| 108 | Ga0466691_012716 | 3300042593 | Bacteria | 19248 |
| 109 | Ga0466691_093973 | 3300042593 | Bacteria | 13680 |
| 110 | Ga0466696_287535 | 3300042596 | Bacteria | 43348 |
| 111 | 2227063698 | 2225789003 | Bacteria | 16706 |
| 112 | IMNBL1DRAFT_c0001124 | 3300000062 | Bacteria | 20490 |
| 113 | IMNBL1DRAFT_c0003741 | 3300000062 | Bacteria | 9531 |
| 114 | Ga0466704_154577 | 3300042643 | Bacteria | 5663 |
| 115 | Ga0466725_276656 | 3300042654 | Bacteria | 14850 |
| 116 | Ga0466715_276082 | 3300042616 | Bacteria | 11278 |
| 117 | Ga0466706_074142 | 3300042599 | Bacteria | 4572 |
| 118 | Ga0466713_010003 | 3300042602 | Bacteria | 49152 |
| 119 | Ga0466713_072265 | 3300042602 | Bacteria | 40264 |
| 120 | Ga0466713_131403 | 3300042602 | Bacteria | 18174 |
| 121 | Ga0466716_151716 | 3300042605 | Bacteria | 6578 |
| 122 | Ga0466716_406042 | 3300042605 | Bacteria | 10247 |
| 123 | Ga0466719_388022 | 3300042606 | Bacteria | 1784 |
| 124 | 2227479082 | 2225789004 | Bacteria | 4510 |
| 125 | IMNBL1DRAFT_c0000298 | 3300000062 | Bacteria | 42272 |
| 126 | JGI24702J35022_10003307 | 3300002462 | Bacteria | 9734 |
| 127 | Ga0072941_1037155 | 3300005201 | Bacteria | 1011 |
| 128 | Ga0466697_111290 | 3300042611 | Bacteria | 3464 |
| 129 | Ga0466705_170838 | 3300042612 | Bacteria | 23934 |
| 130 | Ga0466704_195693 | 3300042643 | Bacteria | 31218 |
| 131 | Ga0466709_265193 | 3300042648 | Bacteria | 3862 |
| 132 | Ga0466709_274511 | 3300042648 | Bacteria | 1222 |
| 133 | Ga0466725_035263 | 3300042654 | Bacteria | 13140 |
| 134 | Ga0466727_227644 | 3300042655 | Bacteria | 3823 |
| 135 | Ga0466711_028440 | 3300042615 | Bacteria | 19103 |
| 136 | Ga0466711_083476 | 3300042615 | Bacteria | 22236 |
| 137 | Ga0466715_546218 | 3300042616 | Bacteria | 6555 |
| 138 | Ga0466723_200935 | 3300042618 | Bacteria | 15193 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01553 | GO:0016746 | acyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.