Protein Family IF08308

Metagenome Isolate
178 Members
74 Samples
154 Scaffolds
212.69 Avg Length

🧬 Representative Sequence

ID
3300042619|Ga0466726_337270|Ga0466726_337270_172_930
Length
252 aa
Sequence
MTTPTPCTKRCNKSQQNFNSYWNYFPLSIGILLSLQKFFVEKMERLKSLGVIPVNKDILYLLFSDLKFPENKISRLESKQLIIRIKRNLYVVSKQVHNQEISRELVANHLYGPSYVSLESALAYYGLIPERVFAMRSVCTKLRKQYETPVGHFEYVKVPEKYFQIGVNQEIIDNSYSFLIASPEKALCDKIVTTQNIRIQSVKAMNEYLEEDLRFEMSALTSFNIDIIEECLEFGKKKTELTQLLKLLSYGK

📊 Sample Types

Isolate 13.5%
Metagenome 86.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Unclassified 18.1%
Blattidae 18.1%
Kalotermitidae 16.7%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Culicidae 1.4%
Passalidae 1.4%
Armadillidiidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820852808 Unclassified Actinobacteria Lab288P3bin25 Isolate Unclassified
2 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
3 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
4 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
5 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
6 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
7 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
8 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
9 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
23 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
24 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
25 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
26 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
27 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
28 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
31 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
32 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
33 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
34 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
35 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
36 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
37 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
38 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
39 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
40 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
41 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
42 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
43 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
44 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
45 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
46 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
47 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
48 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
49 2820799971 Unclassified Actinobacteria Th196P4bin46 Isolate Unclassified
50 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
51 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
53 3004677695 Bacteroides sp. 214 Isolate Blattidae
54 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
55 2778260939 Unclassified Fibrobacteres Co191P4bin13 Isolate Unclassified
56 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
57 2820866620 Unclassified Actinobacteria Lab288P3bin139 Isolate Unclassified
58 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
59 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
60 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
61 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
62 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
63 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
64 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
65 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
66 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
67 2820874551 Unclassified Actinobacteria Lab288P1bin85 Isolate Unclassified
68 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
69 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
70 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
71 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
72 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
73 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
74 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_213786 3300042590 Bacteria 2919
2 Ga0466693_447514 3300042592 Unclassified 2283
3 Ga0466691_071232 3300042593 Bacteria 1199
4 Ga0466691_119228 3300042593 Bacteria 1127
5 Ga0466694_388666 3300042594 Bacteria 2909
6 Ga0466696_120561 3300042596 Bacteria 43533
7 Ga0466718_019458 3300042617 Bacteria 4570
8 Ga0466726_229389 3300042619 Bacteria 1115
9 Ga0466726_410369 3300042619 Bacteria 1576
10 Ga0466729_182662 3300042621 Bacteria 4895
11 Ga0123357_10009403 3300009784 Bacteria 12344
12 Ga0123357_10215479 3300009784 Bacteria 2145
13 Ga0123353_10000156 3300010167 Bacteria 86182
14 Ga0123354_10154482 3300010882 Bacteria 2761
15 Ga0466706_068592 3300042599 Bacteria 2413
16 Ga0466707_359555 3300042601 Bacteria 1648
17 Ga0466707_365496 3300042601 Bacteria 1183
18 Ga0466704_140169 3300042643 Bacteria 11571
19 Ga0466704_218407 3300042643 Unclassified 2135
20 Ga0466696_053605 3300042596 Bacteria 9771
21 Ga0466699_025362 3300042597 Bacteria 4346
22 JGI24702J35022_10034437 3300002462 Bacteria 2708
23 JGI24696J40584_12956062 3300002834 Unclassified 2999
24 Ga0466697_121868 3300042611 Bacteria 1937
25 Ga0466710_023849 3300042613 Bacteria 4937
26 Ga0466715_079052 3300042616 Bacteria 26117
27 Ga0466726_337270 3300042619 Bacteria 2075
28 Ga0466728_102440 3300042620 Bacteria 3318
29 Ga0466729_076109 3300042621 Bacteria 1305
30 Ga0123353_10026317 3300010167 Bacteria 8882
31 Ga0123354_10000039 3300010882 Bacteria 96874
32 Ga0123354_10326871 3300010882 Bacteria 1405
33 Ga0466707_197642 3300042601 Bacteria 2721
34 Ga0466707_262686 3300042601 Bacteria 12130
35 Ga0466714_128718 3300042603 Bacteria 1259
36 Ga0466714_153823 3300042603 Bacteria 20213
37 Ga0466716_455839 3300042605 Bacteria 1508
38 Ga0466719_050021 3300042606 Bacteria 4533
39 Ga0466719_115033 3300042606 Bacteria 5437
40 Ga0466719_324084 3300042606 Bacteria 11091
41 Ga0466735_045664 3300042624 Bacteria 1952
42 Ga0466735_102162 3300042624 Bacteria 1124
43 Ga0466702_447443 3300042635 Bacteria 1985
44 Ga0466703_329015 3300042636 Bacteria 1130
45 Ga0466704_595711 3300042643 Bacteria 7751
46 Ga0466727_016593 3300042655 Bacteria 5854
47 Ga0466733_092214 3300042659 Bacteria 2040
48 Ga0160445_105700 3300012847 Bacteria 2102
49 Ga0466694_134394 3300042594 Bacteria 3501
50 JGI24702J35022_10023843 3300002462 Bacteria 3307
51 JGI24702J35022_10278185 3300002462 Bacteria 981
52 Ga0072941_1020925 3300005201 Bacteria 46248
53 Ga0072941_1535373 3300005201 Bacteria 1590
54 Ga0466705_380091 3300042612 Bacteria 2466
55 Ga0466711_173137 3300042615 Bacteria 1255
56 Ga0123356_10017878 3300010049 Bacteria 6735
57 Ga0123356_10670773 3300010049 Bacteria 1205
58 Ga0123353_10028157 3300010167 Bacteria 8626
59 Ga0123353_10187091 3300010167 Bacteria 3273
60 Ga0466706_003857 3300042599 Bacteria 1123
61 Ga0466706_048730 3300042599 Bacteria 101759
62 Ga0466717_189017 3300042604 Bacteria 1596
63 Ga0466719_062332 3300042606 Bacteria 3862
64 Ga0466722_133280 3300042609 Bacteria 2165
65 Ga0466734_091237 3300042623 Bacteria 1119
66 Ga0466735_187878 3300042624 Bacteria 1713
67 Ga0466703_167136 3300042636 Bacteria 7019
68 Ga0265387_1002891 3300024582 Bacteria 2401
69 Ga0466690_022945 3300042590 Bacteria 4002
70 Ga0466696_275630 3300042596 Unclassified 2665
71 JGI24696J40584_12856740 3300002834 Unclassified 998
72 Ga0466697_129488 3300042611 Unclassified 1188
73 Ga0466711_123750 3300042615 Bacteria 3703
74 Ga0123353_10000162 3300010167 Bacteria 85033
75 Ga0123354_10597108 3300010882 Bacteria 811
76 Ga0466701_055692 3300042598 Bacteria 2348
77 Ga0466701_088254 3300042598 Bacteria 4920
78 Ga0466706_018564 3300042599 Bacteria 2015
79 Ga0466706_152611 3300042599 Bacteria 7338
80 Ga0466706_251485 3300042599 Bacteria 3296
81 Ga0466707_287850 3300042601 Bacteria 1952
82 Ga0466713_066876 3300042602 Bacteria 4635
83 Ga0466716_345678 3300042605 Bacteria 7271
84 Ga0466656_119430 3300042550 Bacteria 1158
85 Ga0466692_048806 3300042591 Bacteria 3435
86 JGI24696J40584_12961672 3300002834 Bacteria 32101
87 Ga0072941_1054031 3300005201 Bacteria 2196
88 Ga0466712_040374 3300042614 Bacteria 4325
89 Ga0466711_396839 3300042615 Bacteria 15756
90 Ga0466715_389526 3300042616 Bacteria 3452
91 Ga0466726_330012 3300042619 Unclassified 1458
92 Ga0466701_072326 3300042598 Bacteria 1699
93 Ga0466707_056958 3300042601 Bacteria 3061
94 Ga0466707_210308 3300042601 Bacteria 17582
95 Ga0466707_296247 3300042601 Unclassified 1358
96 Ga0466707_381289 3300042601 Bacteria 2504
97 Ga0466717_093118 3300042604 Bacteria 3299
98 Ga0466719_215193 3300042606 Bacteria 1488
99 Ga0466704_215831 3300042643 Bacteria 1835
100 Ga0466704_315685 3300042643 Bacteria 6241
101 Ga0160448_100244 3300012854 Bacteria 21549
102 Ga0466690_147301 3300042590 Unclassified 1370
103 Ga0466691_202092 3300042593 Bacteria 13525
104 IMNBL1DRAFT_c0003927 3300000062 Bacteria 9198
105 JGI24705J35276_12209025 3300002504 Bacteria 1788
106 JGI24696J40584_12959483 3300002834 Bacteria 5189
107 Ga0466697_116671 3300042611 Unclassified 1346
108 Ga0466697_145298 3300042611 Bacteria 1958
109 Ga0466705_349982 3300042612 Bacteria 13426
110 Ga0466728_305456 3300042620 Bacteria 2039
111 Ga0123356_10155113 3300010049 Bacteria 2279
112 Ga0123353_10064807 3300010167 Bacteria 5864
113 Ga0123354_10275956 3300010882 Bacteria 1643
114 Ga0123354_10454003 3300010882 Bacteria 1035
115 Ga0466701_036776 3300042598 Bacteria 10400
116 Ga0466706_218048 3300042599 Bacteria 1619
117 Ga0466707_018717 3300042601 Bacteria 1528
118 Ga0466707_058494 3300042601 Bacteria 5520
119 Ga0466707_130522 3300042601 Bacteria 13733
120 Ga0466707_136599 3300042601 Bacteria 6398
121 Ga0466704_524730 3300042643 Bacteria 1392
122 Ga0466656_119719 3300042550 Bacteria 2717
123 Ga0466692_102782 3300042591 Bacteria 2552
124 JGI24702J35022_10004794 3300002462 Bacteria 7990
125 Ga0072941_1733809 3300005201 Bacteria 1004
126 Ga0466705_519878 3300042612 Bacteria 4950
127 Ga0466711_513307 3300042615 Bacteria 1263
128 Ga0466715_144212 3300042616 Bacteria 7014
129 Ga0466726_301509 3300042619 Bacteria 3824
130 Ga0123357_10198482 3300009784 Bacteria 2291
131 Ga0123356_10004807 3300010049 Archaea 13895
132 Ga0466707_098287 3300042601 Bacteria 2731
133 Ga0466707_211066 3300042601 Bacteria 3878
134 Ga0466714_127045 3300042603 Bacteria 2244
135 Ga0466731_308050 3300042622 Bacteria 2129
136 Ga0466735_224803 3300042624 Bacteria 3000
137 Ga0466704_074706 3300042643 Bacteria 8083
138 Ga0466704_300116 3300042643 Unclassified 1856
139 Ga0466733_167180 3300042659 Bacteria 1733
140 Ga0466693_106200 3300042592 Unclassified 1510
141 JGI24695J34938_10008590 3300002450 Unclassified 5805
142 JGI24705J35276_12034857 3300002504 Bacteria 894
143 JGI24705J35276_12226295 3300002504 Bacteria 2839
144 Ga0466711_510987 3300042615 Bacteria 5322
145 Ga0466728_098176 3300042620 Bacteria 1258
146 Ga0123357_10204170 3300009784 Bacteria 2240
147 Ga0123357_10221992 3300009784 Bacteria 2094
148 Ga0123356_10772235 3300010049 Bacteria 1132
149 Ga0123354_10002888 3300010882 Bacteria 23291
150 Ga0466706_015616 3300042599 Bacteria 4373
151 Ga0466714_117948 3300042603 Bacteria 12128
152 Ga0466719_133650 3300042606 Bacteria 5849
153 Ga0466708_156274 3300042652 Bacteria 5526
154 Ga0466725_086267 3300042654 Bacteria 8282

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_300116 Ga0466704_300116_407_961 184
2 iso_pr_bacteria 2820357977 2820359261 197
3 iso_pr_bacteria 2820833147 2820833506 197
4 3300010882 Ga0123354_10000039 Ga0123354_1000003975 198
5 3300042599 Ga0466706_003857 Ga0466706_003857_368_985 205
6 3300042599 Ga0466706_068592 Ga0466706_068592_488_1105 205
7 3300042599 Ga0466706_015616 Ga0466706_015616_2045_2665 206
8 3300042621 Ga0466729_076109 Ga0466729_076109_358_978 206
9 3300042659 Ga0466733_092214 Ga0466733_092214_464_1084 206
10 3300042659 Ga0466733_167180 Ga0466733_167180_385_1005 206
11 iso_pr_bacteria 2940205530 2940205707 206
12 iso_pr_bacteria 2940212447 2940212624 206
13 iso_pr_bacteria 2940298504 2940298681 206
14 iso_pr_bacteria 2940302308 2940302485 206
15 iso_pr_bacteria 2940306115 2940306614 206
16 iso_pr_bacteria 2940309933 2940310404 206
17 iso_pr_bacteria 2940313741 2940314215 206
18 iso_pr_bacteria 2940317558 2940318029 206
19 iso_pr_bacteria 2940321370 2940321868 206
20 iso_pr_bacteria 2940325180 2940325399 206
21 iso_pr_bacteria 2940328985 2940329205 206
22 iso_pr_bacteria 2940332795 2940333294 206
23 3300042624 Ga0466735_102162 Ga0466735_102162_174_797 207
24 3300024582 Ga0265387_1002891 Ga0265387_10028913 208
25 3300042591 Ga0466692_048806 Ga0466692_048806_1022_1648 208
26 3300042593 Ga0466691_071232 Ga0466691_071232_169_795 208
27 3300042593 Ga0466691_119228 Ga0466691_119228_214_840 208
28 3300042599 Ga0466706_018564 Ga0466706_018564_182_808 208
29 3300042599 Ga0466706_152611 Ga0466706_152611_6241_6867 208
30 3300042599 Ga0466706_251485 Ga0466706_251485_2199_2825 208
31 3300042603 Ga0466714_127045 Ga0466714_127045_149_775 208
32 3300042603 Ga0466714_128718 Ga0466714_128718_562_1188 208
33 3300042603 Ga0466714_153823 Ga0466714_153823_4300_4926 208
34 3300042609 Ga0466722_133280 Ga0466722_133280_1024_1650 208
35 iso_pr_bacteria 3004677695 3004680029 208
36 3300002834 JGI24696J40584_12856740 JGI24696J40584_128567402 209
37 3300042596 Ga0466696_120561 Ga0466696_120561_38771_39400 209
38 3300042599 Ga0466706_048730 Ga0466706_048730_1916_2545 209
39 3300042601 Ga0466707_130522 Ga0466707_130522_4596_5225 209
40 3300042601 Ga0466707_210308 Ga0466707_210308_2243_2872 209
41 3300042601 Ga0466707_287850 Ga0466707_287850_525_1154 209
42 3300042601 Ga0466707_381289 Ga0466707_381289_1336_1965 209
43 3300042606 Ga0466719_115033 Ga0466719_115033_1799_2428 209
44 3300042613 Ga0466710_023849 Ga0466710_023849_2458_3087 209
45 3300042616 Ga0466715_389526 Ga0466715_389526_2172_2801 209
46 3300000062 IMNBL1DRAFT_c0003927 IMNBL1DRAFT_00039272 210
47 3300002462 JGI24702J35022_10004794 JGI24702J35022_100047946 210
48 3300010167 Ga0123353_10064807 Ga0123353_100648073 210
49 3300010882 Ga0123354_10597108 Ga0123354_105971081 210
50 3300042550 Ga0466656_119430 Ga0466656_119430_266_898 210
51 3300042590 Ga0466690_213786 Ga0466690_213786_1245_1877 210
52 3300042592 Ga0466693_106200 Ga0466693_106200_357_989 210
53 3300042598 Ga0466701_036776 Ga0466701_036776_2038_2670 210
54 3300042598 Ga0466701_072326 Ga0466701_072326_545_1177 210
55 3300042598 Ga0466701_088254 Ga0466701_088254_1153_1785 210
56 3300042601 Ga0466707_098287 Ga0466707_098287_1074_1706 210
57 3300042601 Ga0466707_197642 Ga0466707_197642_2002_2634 210
58 3300042601 Ga0466707_365496 Ga0466707_365496_135_767 210
59 3300042604 Ga0466717_093118 Ga0466717_093118_1785_2417 210
60 3300042605 Ga0466716_455839 Ga0466716_455839_27_659 210
61 3300042606 Ga0466719_062332 Ga0466719_062332_339_971 210
62 3300042606 Ga0466719_133650 Ga0466719_133650_690_1322 210
63 3300042606 Ga0466719_215193 Ga0466719_215193_460_1092 210
64 3300042606 Ga0466719_324084 Ga0466719_324084_6879_7511 210
65 3300042611 Ga0466697_121868 Ga0466697_121868_363_995 210
66 3300042611 Ga0466697_129488 Ga0466697_129488_144_776 210
67 3300042611 Ga0466697_145298 Ga0466697_145298_1164_1796 210
68 3300042612 Ga0466705_349982 Ga0466705_349982_11800_12432 210
69 3300042615 Ga0466711_123750 Ga0466711_123750_124_756 210
70 3300042615 Ga0466711_510987 Ga0466711_510987_4397_5029 210
71 3300042615 Ga0466711_513307 Ga0466711_513307_320_952 210
72 3300042619 Ga0466726_229389 Ga0466726_229389_169_801 210
73 3300042619 Ga0466726_301509 Ga0466726_301509_2468_3100 210
74 3300042619 Ga0466726_410369 Ga0466726_410369_797_1429 210
75 3300042622 Ga0466731_308050 Ga0466731_308050_1439_2071 210
76 3300042624 Ga0466735_045664 Ga0466735_045664_894_1526 210
77 3300042635 Ga0466702_447443 Ga0466702_447443_737_1369 210
78 3300042643 Ga0466704_074706 Ga0466704_074706_4705_5337 210
79 3300042652 Ga0466708_156274 Ga0466708_156274_2982_3614 210
80 3300042654 Ga0466725_086267 Ga0466725_086267_3847_4479 210
81 3300042655 Ga0466727_016593 Ga0466727_016593_78_710 210
82 iso_pr_bacteria 2820744581 2820744674 210
83 3300002462 JGI24702J35022_10034437 JGI24702J35022_100344372 211
84 3300002462 JGI24702J35022_10278185 JGI24702J35022_102781851 211
85 3300002504 JGI24705J35276_12226295 JGI24705J35276_122262951 211
86 3300002834 JGI24696J40584_12956062 JGI24696J40584_129560622 211
87 3300005201 Ga0072941_1535373 Ga0072941_15353732 211
88 3300009784 Ga0123357_10204170 Ga0123357_102041703 211
89 3300010167 Ga0123353_10026317 Ga0123353_100263174 211
90 3300010167 Ga0123353_10187091 Ga0123353_101870912 211
91 3300010882 Ga0123354_10326871 Ga0123354_103268712 211
92 3300010882 Ga0123354_10454003 Ga0123354_104540032 211
93 3300042597 Ga0466699_025362 Ga0466699_025362_2901_3536 211
94 3300042601 Ga0466707_262686 Ga0466707_262686_6252_6887 211
95 3300042601 Ga0466707_359555 Ga0466707_359555_222_857 211
96 3300042603 Ga0466714_117948 Ga0466714_117948_3551_4186 211
97 3300042604 Ga0466717_189017 Ga0466717_189017_409_1044 211
98 3300042614 Ga0466712_040374 Ga0466712_040374_1275_1910 211
99 3300042615 Ga0466711_396839 Ga0466711_396839_1590_2225 211
100 3300042616 Ga0466715_144212 Ga0466715_144212_315_950 211
101 3300042617 Ga0466718_019458 Ga0466718_019458_2430_3065 211
102 3300042643 Ga0466704_140169 Ga0466704_140169_1386_2021 211
103 iso_pr_bacteria 2740892545 2743907931 211
104 iso_pr_bacteria 2778260939 2778354912 211
105 3300002450 JGI24695J34938_10008590 JGI24695J34938_100085902 212
106 3300002834 JGI24696J40584_12961672 JGI24696J40584_1296167232 212
107 3300005201 Ga0072941_1020925 Ga0072941_102092540 212
108 3300005201 Ga0072941_1054031 Ga0072941_10540311 212
109 3300009784 Ga0123357_10198482 Ga0123357_101984822 212
110 3300009784 Ga0123357_10221992 Ga0123357_102219922 212
111 3300010049 Ga0123356_10004807 Ga0123356_1000480712 212
112 3300010049 Ga0123356_10017878 Ga0123356_100178784 212
113 3300010882 Ga0123354_10275956 Ga0123354_102759561 212
114 3300042601 Ga0466707_296247 Ga0466707_296247_347_985 212
115 3300042612 Ga0466705_519878 Ga0466705_519878_3807_4445 212
116 3300042621 Ga0466729_182662 Ga0466729_182662_2493_3131 212
117 3300042643 Ga0466704_218407 Ga0466704_218407_1095_1733 212
118 3300042643 Ga0466704_524730 Ga0466704_524730_352_990 212
119 iso_pr_bacteria 2754412483 2755217119 212
120 3300010049 Ga0123356_10155113 Ga0123356_101551133 213
121 3300010882 Ga0123354_10002888 Ga0123354_100028885 213
122 3300012847 Ga0160445_105700 Ga0160445_1057002 213
123 3300042594 Ga0466694_134394 Ga0466694_134394_1933_2574 213
124 3300042599 Ga0466706_218048 Ga0466706_218048_742_1383 213
125 3300042605 Ga0466716_345678 Ga0466716_345678_3975_4616 213
126 3300042615 Ga0466711_173137 Ga0466711_173137_31_672 213
127 3300042620 Ga0466728_305456 Ga0466728_305456_952_1593 213
128 3300042636 Ga0466703_329015 Ga0466703_329015_351_992 213
129 3300042643 Ga0466704_215831 Ga0466704_215831_786_1427 213
130 iso_pr_bacteria 2820799971 2820800517 213
131 3300002462 JGI24702J35022_10023843 JGI24702J35022_100238432 214
132 3300042601 Ga0466707_058494 Ga0466707_058494_1581_2225 214
133 3300042624 Ga0466735_187878 Ga0466735_187878_262_906 214
134 3300042593 Ga0466691_202092 Ga0466691_202092_6241_6888 215
135 3300042596 Ga0466696_275630 Ga0466696_275630_805_1452 215
136 3300042619 Ga0466726_330012 Ga0466726_330012_318_965 215
137 3300042623 Ga0466734_091237 Ga0466734_091237_86_733 215
138 3300042590 Ga0466690_022945 Ga0466690_022945_2186_2836 216
139 3300042590 Ga0466690_147301 Ga0466690_147301_362_1012 216
140 3300042606 Ga0466719_050021 Ga0466719_050021_989_1639 216
141 iso_pr_bacteria 2820823448 2820824484 216
142 3300005201 Ga0072941_1733809 Ga0072941_17338091 217
143 3300009784 Ga0123357_10009403 Ga0123357_100094034 217
144 3300010049 Ga0123356_10670773 Ga0123356_106707731 217
145 3300042592 Ga0466693_447514 Ga0466693_447514_606_1259 217
146 3300042596 Ga0466696_053605 Ga0466696_053605_2012_2665 217
147 iso_pr_bacteria 2820852808 2820852868 217
148 iso_pr_bacteria 2820866620 2820866708 217
149 iso_pr_bacteria 2820874551 2820875743 217
150 3300010167 Ga0123353_10000156 Ga0123353_1000015654 218
151 3300010167 Ga0123353_10028157 Ga0123353_100281575 218
152 3300010882 Ga0123354_10154482 Ga0123354_101544824 218
153 3300002504 JGI24705J35276_12034857 JGI24705J35276_120348571 219
154 3300042602 Ga0466713_066876 Ga0466713_066876_2800_3459 219
155 3300042611 Ga0466697_116671 Ga0466697_116671_523_1182 219
156 3300042620 Ga0466728_098176 Ga0466728_098176_166_825 219
157 3300042624 Ga0466735_224803 Ga0466735_224803_323_982 219
158 3300042643 Ga0466704_315685 Ga0466704_315685_3153_3815 220
159 3300042601 Ga0466707_018717 Ga0466707_018717_731_1396 221
160 3300042601 Ga0466707_211066 Ga0466707_211066_609_1274 221
161 3300042636 Ga0466703_167136 Ga0466703_167136_4672_5337 221
162 3300010167 Ga0123353_10000162 Ga0123353_1000016280 223
163 3300042601 Ga0466707_056958 Ga0466707_056958_405_1076 223
164 3300002504 JGI24705J35276_12209025 JGI24705J35276_122090252 224
165 3300002834 JGI24696J40584_12959483 JGI24696J40584_129594834 224
166 3300042601 Ga0466707_136599 Ga0466707_136599_3035_3709 224
167 3300042591 Ga0466692_102782 Ga0466692_102782_845_1522 225
168 3300042550 Ga0466656_119719 Ga0466656_119719_838_1518 226
169 3300042616 Ga0466715_079052 Ga0466715_079052_9953_10633 226
170 3300042620 Ga0466728_102440 Ga0466728_102440_1949_2629 226
171 3300042643 Ga0466704_595711 Ga0466704_595711_5327_6010 227
172 3300012854 Ga0160448_100244 Ga0160448_1002442 228
173 3300042594 Ga0466694_388666 Ga0466694_388666_2173_2859 228
174 3300010049 Ga0123356_10772235 Ga0123356_107722352 230
175 3300042612 Ga0466705_380091 Ga0466705_380091_395_1087 230
176 3300042598 Ga0466701_055692 Ga0466701_055692_1178_1879 233
177 3300042619 Ga0466726_337270 Ga0466726_337270_172_930 252
178 3300009784 Ga0123357_10215479 Ga0123357_102154792 266

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.