Protein Family IF08300
Metagenome
Isolate
138
Members
54
Samples
126
Scaffolds
248.6
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_310071|Ga0466726_310071_4715_5536
- Length
- 273 aa
- Sequence
- MRAWIEKIRSKAFMDRKINVTIYNENLHETTVDSVRALYPNGIHGVIKGFLEKDSAIGTIRCATFADHKEILTQQVLDDTDVMIWWGHMKHDAVDDAVVXXXVTRVLGGMGFIALHSGHASKPFGRLLGTETHLLRWREAGEKARLWNIAKNHRITKGLPQTFVVPHDETYGEPFGIPEPDELIFLTWFQGGEVFRSGCAWRRGEGNIFYLQNGHETFPVYYQPEIQLVISNAVHWACPVQRVCTLDRGGPNAAPLEAYTLEDGGGFTPITRS
Sample Types
Isolate
8.0%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.9%
Kalotermitidae
22.2%
Unclassified
20.4%
Rhinotermitidae
7.4%
Termopsidae
5.6%
Passalidae
3.7%
Hodotermitidae
1.9%
Taxonomy
Archaea
2
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 9 | 2820429680 | Unclassified Firmicutes Lab288P3bin30 | Isolate | Unclassified |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 22 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 23 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 24 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 27 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 31 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 41 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 42 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 43 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 44 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 47 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 48 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 49 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 50 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 51 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 52 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 53 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 54 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466720_181167 | 3300042607 | Bacteria | 1914 |
| 2 | Ga0123356_10674157 | 3300010049 | Bacteria | 1202 |
| 3 | Ga0123353_10016205 | 3300010167 | Bacteria | 10879 |
| 4 | Ga0123353_10317609 | 3300010167 | Bacteria | 2366 |
| 5 | Ga0415639_022500 | 3300038395 | Bacteria | 4726 |
| 6 | Ga0466691_177072 | 3300042593 | Bacteria | 1530 |
| 7 | JGI24702J35022_10009341 | 3300002462 | Bacteria | 5506 |
| 8 | JGI24696J40584_12959513 | 3300002834 | Bacteria | 5228 |
| 9 | JGI24696J40584_12960447 | 3300002834 | Bacteria | 7280 |
| 10 | Ga0466705_443902 | 3300042612 | Bacteria | 4145 |
| 11 | Ga0466726_310071 | 3300042619 | Bacteria | 9297 |
| 12 | Ga0466728_062721 | 3300042620 | Bacteria | 4279 |
| 13 | Ga0466703_151321 | 3300042636 | Bacteria | 26945 |
| 14 | Ga0466727_129586 | 3300042655 | Bacteria | 2690 |
| 15 | Ga0466727_150207 | 3300042655 | Bacteria | 2374 |
| 16 | Ga0123353_10000539 | 3300010167 | Bacteria | 46894 |
| 17 | Ga0123353_10027320 | 3300010167 | Bacteria | 8744 |
| 18 | Ga0123353_10045734 | 3300010167 | Bacteria | 6950 |
| 19 | Ga0123353_10296520 | 3300010167 | Bacteria | 2472 |
| 20 | Ga0123353_10691068 | 3300010167 | Bacteria | 1434 |
| 21 | Ga0466693_007221 | 3300042592 | Bacteria | 1367 |
| 22 | Ga0466699_129934 | 3300042597 | Bacteria | 3966 |
| 23 | Ga0466699_215643 | 3300042597 | Bacteria | 1260 |
| 24 | IMNBL1DRAFT_c0002747 | 3300000062 | Unclassified | 11962 |
| 25 | JGI24702J35022_10005627 | 3300002462 | Bacteria | 7306 |
| 26 | Ga0466718_131007 | 3300042617 | Bacteria | 2291 |
| 27 | Ga0466705_049050 | 3300042612 | Bacteria | 6405 |
| 28 | Ga0466729_216908 | 3300042621 | Bacteria | 16052 |
| 29 | Ga0466731_253896 | 3300042622 | Bacteria | 1947 |
| 30 | Ga0466703_009474 | 3300042636 | Bacteria | 5907 |
| 31 | Ga0466704_154549 | 3300042643 | Bacteria | 24370 |
| 32 | Ga0466708_271808 | 3300042652 | Bacteria | 5080 |
| 33 | Ga0466701_043274 | 3300042598 | Bacteria | 1715 |
| 34 | Ga0466719_388875 | 3300042606 | Bacteria | 2045 |
| 35 | Ga0466719_423876 | 3300042606 | Bacteria | 8084 |
| 36 | Ga0123356_10301634 | 3300010049 | Bacteria | 1707 |
| 37 | Ga0123353_10190365 | 3300010167 | Bacteria | 3239 |
| 38 | Ga0123354_10489535 | 3300010882 | Unclassified | 966 |
| 39 | Ga0415639_108022 | 3300038395 | Bacteria | 5011 |
| 40 | Ga0466690_059556 | 3300042590 | Bacteria | 1757 |
| 41 | Ga0466694_012479 | 3300042594 | Bacteria | 1760 |
| 42 | Ga0466694_403891 | 3300042594 | Bacteria | 1982 |
| 43 | 2227303005 | 2225789004 | Bacteria | 29397 |
| 44 | JGI24702J35022_10029215 | 3300002462 | Unclassified | 2959 |
| 45 | Ga0466723_146583 | 3300042618 | Bacteria | 4513 |
| 46 | Ga0466728_021715 | 3300042620 | Unclassified | 3713 |
| 47 | Ga0466705_217315 | 3300042612 | Bacteria | 6855 |
| 48 | Ga0466704_273736 | 3300042643 | Unclassified | 3763 |
| 49 | Ga0466709_009097 | 3300042648 | Unclassified | 14066 |
| 50 | Ga0466708_047798 | 3300042652 | Bacteria | 3805 |
| 51 | Ga0466722_164901 | 3300042609 | Bacteria | 1597 |
| 52 | Ga0123356_10023173 | 3300010049 | Bacteria | 5848 |
| 53 | Ga0123356_10502613 | 3300010049 | Bacteria | 1368 |
| 54 | Ga0123356_10808635 | 3300010049 | Bacteria | 1108 |
| 55 | Ga0456237_0008522 | 3300041968 | Bacteria | 1544 |
| 56 | Ga0466691_052044 | 3300042593 | Bacteria | 24535 |
| 57 | Ga0466691_199020 | 3300042593 | Bacteria | 3353 |
| 58 | Ga0466726_318983 | 3300042619 | Bacteria | 2466 |
| 59 | Ga0466726_438498 | 3300042619 | Bacteria | 1085 |
| 60 | Ga0466727_106293 | 3300042655 | Bacteria | 1227 |
| 61 | Ga0466727_241335 | 3300042655 | Bacteria | 6689 |
| 62 | Ga0466727_266548 | 3300042655 | Unclassified | 2509 |
| 63 | Ga0466733_007910 | 3300042659 | Bacteria | 2002 |
| 64 | Ga0466707_351852 | 3300042601 | Bacteria | 4703 |
| 65 | Ga0466719_221593 | 3300042606 | Bacteria | 8967 |
| 66 | Ga0123355_10106616 | 3300009826 | Bacteria | 4393 |
| 67 | Ga0123356_10021658 | 3300010049 | Bacteria | 6066 |
| 68 | Ga0123356_10107252 | 3300010049 | Bacteria | 2691 |
| 69 | Ga0123354_10423720 | 3300010882 | Bacteria | 1103 |
| 70 | Ga0466690_009127 | 3300042590 | Bacteria | 6648 |
| 71 | Ga0466715_136168 | 3300042616 | Bacteria | 23992 |
| 72 | Ga0466723_240466 | 3300042618 | Bacteria | 15139 |
| 73 | Ga0466703_051734 | 3300042636 | Bacteria | 4928 |
| 74 | Ga0466704_482461 | 3300042643 | Bacteria | 2979 |
| 75 | Ga0466733_159567 | 3300042659 | Unclassified | 1263 |
| 76 | Ga0123353_10078498 | 3300010167 | Bacteria | 5306 |
| 77 | Ga0123353_10103036 | 3300010167 | Unclassified | 4600 |
| 78 | Ga0123354_10420427 | 3300010882 | Archaea | 1111 |
| 79 | Ga0466696_238986 | 3300042596 | Bacteria | 3275 |
| 80 | Ga0466699_001046 | 3300042597 | Bacteria | 6902 |
| 81 | JGI24702J35022_10007589 | 3300002462 | Bacteria | 6207 |
| 82 | JGI24705J35276_12223574 | 3300002504 | Bacteria | 2524 |
| 83 | Ga0466718_170298 | 3300042617 | Bacteria | 16664 |
| 84 | Ga0466723_254832 | 3300042618 | Bacteria | 8953 |
| 85 | Ga0466726_105607 | 3300042619 | Bacteria | 4333 |
| 86 | Ga0466705_054847 | 3300042612 | Bacteria | 8005 |
| 87 | Ga0466703_041775 | 3300042636 | Bacteria | 7763 |
| 88 | Ga0466727_001217 | 3300042655 | Bacteria | 1351 |
| 89 | Ga0466727_039508 | 3300042655 | Bacteria | 3023 |
| 90 | Ga0466727_283679 | 3300042655 | Bacteria | 2246 |
| 91 | Ga0466733_012094 | 3300042659 | Unclassified | 1379 |
| 92 | Ga0466706_009298 | 3300042599 | Bacteria | 6037 |
| 93 | Ga0123353_10192755 | 3300010167 | Unclassified | 3215 |
| 94 | Ga0415639_077284 | 3300038395 | Bacteria | 4045 |
| 95 | Ga0415639_090963 | 3300038395 | Bacteria | 3474 |
| 96 | Ga0466694_223825 | 3300042594 | Bacteria | 36366 |
| 97 | Ga0466694_249415 | 3300042594 | Bacteria | 1320 |
| 98 | Ga0466696_157311 | 3300042596 | Bacteria | 7047 |
| 99 | Ga0466696_179610 | 3300042596 | Bacteria | 4353 |
| 100 | JGI24695J34938_10000079 | 3300002450 | Bacteria | 82620 |
| 101 | JGI24702J35022_10010274 | 3300002462 | Unclassified | 5234 |
| 102 | Ga0466735_142440 | 3300042624 | Bacteria | 3251 |
| 103 | Ga0466704_019245 | 3300042643 | Bacteria | 5002 |
| 104 | Ga0466704_464040 | 3300042643 | Unclassified | 2947 |
| 105 | Ga0466733_170153 | 3300042659 | Bacteria | 1157 |
| 106 | Ga0466713_030932 | 3300042602 | Bacteria | 92656 |
| 107 | Ga0466714_161898 | 3300042603 | Bacteria | 1254 |
| 108 | Ga0466719_029177 | 3300042606 | Bacteria | 2365 |
| 109 | Ga0466719_178000 | 3300042606 | Bacteria | 20502 |
| 110 | Ga0123356_10123106 | 3300010049 | Bacteria | 2527 |
| 111 | Ga0123356_10451694 | 3300010049 | Bacteria | 1433 |
| 112 | Ga0123353_10000420 | 3300010167 | Bacteria | 52431 |
| 113 | Ga0123353_10039618 | 3300010167 | Bacteria | 7422 |
| 114 | Ga0466692_069907 | 3300042591 | Unclassified | 1644 |
| 115 | Ga0466699_003624 | 3300042597 | Bacteria | 19542 |
| 116 | Ga0466699_115488 | 3300042597 | Bacteria | 3783 |
| 117 | Ga0466699_402130 | 3300042597 | Bacteria | 1804 |
| 118 | IMNBL1DRAFT_c0000022 | 3300000062 | Bacteria | 148036 |
| 119 | AustNasuHG_c1038409 | 3300000089 | Bacteria | 1206 |
| 120 | Ga0072940_1427068 | 3300005200 | Bacteria | 942 |
| 121 | Ga0466726_162097 | 3300042619 | Bacteria | 1112 |
| 122 | Ga0466726_433112 | 3300042619 | Archaea | 1401 |
| 123 | Ga0466703_025105 | 3300042636 | Bacteria | 4646 |
| 124 | Ga0466703_200655 | 3300042636 | Bacteria | 4636 |
| 125 | Ga0466703_347080 | 3300042636 | Bacteria | 10047 |
| 126 | Ga0466727_153418 | 3300042655 | Bacteria | 1897 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06283 | ThuA | Trehalose utilisation | 20 | 237 | 0.79 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.