Protein Family IF08282
Metagenome
Isolate
174
Members
87
Samples
154
Scaffolds
87.51
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_256018|Ga0466726_256018_419_733
- Length
- 104 aa
- Sequence
- MAHKKGVGSSRNGRDSHSKRLGVKLFGGQVVKAGNIIVRQRGTVHYPGVNVGIGRDHTLFALTDGIITFVKKSKGRSYVSVFPASVSVARVSLTAPAAAAEDAT
Sample Types
Isolate
11.5%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.0%
Unclassified
17.9%
Formicidae
16.7%
Kalotermitidae
16.7%
Termopsidae
4.8%
Blattidae
4.8%
Rhinotermitidae
3.6%
Culicidae
3.6%
Passalidae
3.6%
Armadillidiidae
1.2%
Elmidae
1.2%
Curculionidae
1.2%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
39
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 4 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 5 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 6 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 16 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 22 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 27 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 28 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 29 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 30 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 31 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 32 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 33 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 36 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 37 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 38 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 39 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 45 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 46 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 47 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 48 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 49 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 50 | 2820255904 | Unclassified Firmicutes Th196P3bin48 | Isolate | Unclassified |
| 51 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 52 | 2820127165 | Unclassified Proteobacteria Emb289P3bin90 | Isolate | Unclassified |
| 53 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 54 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 55 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 56 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 61 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 62 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 63 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 64 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 65 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 66 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 67 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 68 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 69 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 70 | 644736337 | Candidatus Sulcia muelleri SMDSEM | Isolate | Unclassified |
| 71 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 72 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 73 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 74 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 75 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 76 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 77 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 78 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 79 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 80 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 81 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 82 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 83 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 84 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 85 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 86 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 87 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10187907 | 3300002462 | Bacteria | 1177 |
| 2 | Ga0072941_1038806 | 3300005201 | Unclassified | 6715 |
| 3 | Ga0102735_1000308 | 3300007080 | Bacteria | 13856 |
| 4 | Ga0102740_1002098 | 3300007140 | Unclassified | 4716 |
| 5 | Ga0102737_1004413 | 3300007142 | Unclassified | 2997 |
| 6 | Ga0103268_1000420 | 3300007192 | Bacteria | 13098 |
| 7 | Ga0123356_10440807 | 3300010049 | Bacteria | 1449 |
| 8 | Ga0123356_11697684 | 3300010049 | Bacteria | 783 |
| 9 | Ga0160447_140677 | 3300012849 | Unclassified | 532 |
| 10 | Ga0466690_157219 | 3300042590 | Unclassified | 11176 |
| 11 | Ga0466691_086914 | 3300042593 | Bacteria | 11733 |
| 12 | Ga0466696_083625 | 3300042596 | Bacteria | 16818 |
| 13 | Ga0466722_074104 | 3300042609 | Bacteria | 13640 |
| 14 | Ga0466711_014509 | 3300042615 | Bacteria | 8042 |
| 15 | Ga0466723_129507 | 3300042618 | Unclassified | 6871 |
| 16 | Ga0466726_018852 | 3300042619 | Bacteria | 5570 |
| 17 | Ga0466728_115899 | 3300042620 | Bacteria | 3397 |
| 18 | Ga0466729_279841 | 3300042621 | Bacteria | 5065 |
| 19 | Ga0466702_072390 | 3300042635 | Bacteria | 3788 |
| 20 | Ga0466703_017812 | 3300042636 | Bacteria | 2358 |
| 21 | Ga0466704_316152 | 3300042643 | Bacteria | 27672 |
| 22 | Ga0466708_017012 | 3300042652 | Bacteria | 13364 |
| 23 | JGI24698J34947_10346118 | 3300002449 | Bacteria | 521 |
| 24 | JGI24696J40584_12366871 | 3300002834 | Bacteria | 542 |
| 25 | Ga0068305_10424593 | 3300005083 | Bacteria | 2131 |
| 26 | Ga0074263_132115 | 3300005485 | Bacteria | 832 |
| 27 | Ga0103266_1000207 | 3300007067 | Bacteria | 16473 |
| 28 | Ga0102734_1051482 | 3300007129 | Unclassified | 1075 |
| 29 | Ga0103260_1000935 | 3300007139 | Unclassified | 5410 |
| 30 | Ga0103264_1010694 | 3300007188 | Bacteria | 5026 |
| 31 | Ga0123353_10031647 | 3300010167 | Bacteria | 8199 |
| 32 | Ga0123353_11616935 | 3300010167 | Bacteria | 817 |
| 33 | Ga0160471_100036 | 3300012812 | Bacteria | 207151 |
| 34 | Ga0466715_311283 | 3300042616 | Bacteria | 27688 |
| 35 | Ga0466723_040344 | 3300042618 | Bacteria | 37666 |
| 36 | Ga0466726_167589 | 3300042619 | Bacteria | 1049 |
| 37 | Ga0466728_421694 | 3300042620 | Bacteria | 4366 |
| 38 | Ga0466697_108104 | 3300042611 | Bacteria | 1116 |
| 39 | Ga0466705_328082 | 3300042612 | Bacteria | 119357 |
| 40 | IMNBL1DRAFT_c0005381 | 3300000062 | Bacteria | 7336 |
| 41 | JGI24702J35022_10795154 | 3300002462 | Bacteria | 589 |
| 42 | JGI24705J35276_12238384 | 3300002504 | Bacteria | 20689 |
| 43 | CVPL010W_10002931 | 3300002931 | Bacteria | 34455 |
| 44 | Ga0102739_1000277 | 3300007095 | Bacteria | 18512 |
| 45 | Ga0103264_1008667 | 3300007188 | Unclassified | 4943 |
| 46 | Ga0466733_190486 | 3300042659 | Bacteria | 10295 |
| 47 | Ga0123356_10029989 | 3300010049 | Bacteria | 5091 |
| 48 | Ga0123356_10030966 | 3300010049 | Unclassified | 5007 |
| 49 | Ga0123353_10574207 | 3300010167 | Bacteria | 1620 |
| 50 | Ga0466692_086250 | 3300042591 | Bacteria | 7712 |
| 51 | Ga0466691_091910 | 3300042593 | Bacteria | 7343 |
| 52 | Ga0466701_020880 | 3300042598 | Bacteria | 1923 |
| 53 | Ga0466716_036421 | 3300042605 | Bacteria | 2768 |
| 54 | Ga0466716_134288 | 3300042605 | Unclassified | 2664 |
| 55 | Ga0466722_030112 | 3300042609 | Unclassified | 2136 |
| 56 | Ga0466711_096967 | 3300042615 | Bacteria | 8034 |
| 57 | Ga0466729_130311 | 3300042621 | Bacteria | 1481 |
| 58 | Ga0466729_178760 | 3300042621 | Bacteria | 4558 |
| 59 | Ga0466703_007439 | 3300042636 | Bacteria | 6980 |
| 60 | 2226980392 | 2225789003 | Bacteria | 9223 |
| 61 | Ga0072941_1043980 | 3300005201 | Bacteria | 4342 |
| 62 | Ga0103260_1001663 | 3300007139 | Unclassified | 3922 |
| 63 | Ga0102740_1001703 | 3300007140 | Unclassified | 5397 |
| 64 | Ga0102738_1000232 | 3300007141 | Unclassified | 11467 |
| 65 | Ga0103268_1050846 | 3300007192 | Bacteria | 1022 |
| 66 | Ga0466732_060256 | 3300042656 | Bacteria | 1178 |
| 67 | Ga0123356_10049146 | 3300010049 | Bacteria | 3926 |
| 68 | Ga0123353_11221403 | 3300010167 | Unclassified | 984 |
| 69 | Ga0415639_007181 | 3300038395 | Bacteria | 24862 |
| 70 | Ga0415639_087163 | 3300038395 | Bacteria | 2731 |
| 71 | Ga0466690_153849 | 3300042590 | Unclassified | 2498 |
| 72 | Ga0466690_343631 | 3300042590 | Unclassified | 7894 |
| 73 | Ga0466696_466247 | 3300042596 | Bacteria | 1033 |
| 74 | Ga0466696_466915 | 3300042596 | Bacteria | 5885 |
| 75 | Ga0466713_068195 | 3300042602 | Bacteria | 2791 |
| 76 | Ga0466713_097534 | 3300042602 | Bacteria | 6228 |
| 77 | Ga0466716_197146 | 3300042605 | Bacteria | 25568 |
| 78 | Ga0466719_324230 | 3300042606 | Bacteria | 1482 |
| 79 | Ga0466703_179101 | 3300042636 | Bacteria | 5372 |
| 80 | Ga0466703_388853 | 3300042636 | Bacteria | 1097 |
| 81 | Ga0466727_307411 | 3300042655 | Bacteria | 80907 |
| 82 | IMNBL1DRAFT_c0003234 | 3300000062 | Bacteria | 10646 |
| 83 | IMNBL1DRAFT_c0015506 | 3300000062 | Unclassified | 3306 |
| 84 | JGI24699J35502_10522512 | 3300002509 | Bacteria | 630 |
| 85 | Ga0103267_1000454 | 3300007190 | Bacteria | 15511 |
| 86 | Ga0466733_043161 | 3300042659 | Bacteria | 7369 |
| 87 | Ga0415639_038000 | 3300038395 | Unclassified | 1227 |
| 88 | Ga0466692_197923 | 3300042591 | Bacteria | 16671 |
| 89 | Ga0466696_449274 | 3300042596 | Bacteria | 35681 |
| 90 | Ga0466701_006346 | 3300042598 | Bacteria | 4058 |
| 91 | Ga0466714_062968 | 3300042603 | Bacteria | 1066 |
| 92 | Ga0466719_339924 | 3300042606 | Bacteria | 4735 |
| 93 | Ga0466722_030292 | 3300042609 | Bacteria | 4148 |
| 94 | Ga0466715_081541 | 3300042616 | Unclassified | 2526 |
| 95 | Ga0466729_031854 | 3300042621 | Bacteria | 3921 |
| 96 | Ga0466735_017024 | 3300042624 | Bacteria | 1437 |
| 97 | Ga0466703_075647 | 3300042636 | Bacteria | 21491 |
| 98 | Ga0466709_182411 | 3300042648 | Bacteria | 7949 |
| 99 | Ga0466709_382557 | 3300042648 | Bacteria | 2857 |
| 100 | Ga0466708_110540 | 3300042652 | Bacteria | 36106 |
| 101 | Ga0102735_1002732 | 3300007080 | Bacteria | 3822 |
| 102 | Ga0102739_1004101 | 3300007095 | Unclassified | 2073 |
| 103 | Ga0160433_130704 | 3300012846 | Bacteria | 604 |
| 104 | Ga0265387_1072270 | 3300024582 | Bacteria | 667 |
| 105 | Ga0415639_105605 | 3300038395 | Bacteria | 6514 |
| 106 | Ga0466691_033071 | 3300042593 | Unclassified | 4498 |
| 107 | Ga0466716_279527 | 3300042605 | Unclassified | 2335 |
| 108 | Ga0466719_328472 | 3300042606 | Unclassified | 1818 |
| 109 | Ga0466715_065360 | 3300042616 | Unclassified | 1555 |
| 110 | Ga0466734_129696 | 3300042623 | Bacteria | 18206 |
| 111 | Ga0466704_354791 | 3300042643 | Unclassified | 1454 |
| 112 | Ga0466708_092849 | 3300042652 | Bacteria | 8043 |
| 113 | Ga0466708_166765 | 3300042652 | Bacteria | 24535 |
| 114 | 2227100262 | 2225789004 | Bacteria | 9602 |
| 115 | IMNBL1DRAFT_c0030871 | 3300000062 | Unclassified | 1957 |
| 116 | JGI24702J35022_10020830 | 3300002462 | Unclassified | 3557 |
| 117 | JGI24702J35022_10022400 | 3300002462 | Bacteria | 3419 |
| 118 | JGI24705J35276_11322924 | 3300002504 | Bacteria | 507 |
| 119 | Ga0102736_1000022 | 3300007052 | Bacteria | 138148 |
| 120 | Ga0123355_10315723 | 3300009826 | Bacteria | 2112 |
| 121 | Ga0123355_10551154 | 3300009826 | Bacteria | 1394 |
| 122 | Ga0123356_10493694 | 3300010049 | Bacteria | 1379 |
| 123 | Ga0160434_100036 | 3300012850 | Bacteria | 115224 |
| 124 | Ga0415639_005878 | 3300038395 | Bacteria | 20658 |
| 125 | Ga0466691_010334 | 3300042593 | Bacteria | 15168 |
| 126 | Ga0466700_297651 | 3300042600 | Bacteria | 1402 |
| 127 | Ga0466713_110834 | 3300042602 | Bacteria | 4725 |
| 128 | Ga0466715_218950 | 3300042616 | Unclassified | 1088 |
| 129 | Ga0466723_014371 | 3300042618 | Unclassified | 14719 |
| 130 | Ga0466726_256018 | 3300042619 | Bacteria | 1324 |
| 131 | Ga0466705_038398 | 3300042612 | Unclassified | 5725 |
| 132 | Ga0466705_199984 | 3300042612 | Bacteria | 74170 |
| 133 | 2227496844 | 2225789004 | Bacteria | 20010 |
| 134 | 2227576850 | 2225789004 | Unclassified | 2553 |
| 135 | IMNBL1DRAFT_c0001029 | 3300000062 | Bacteria | 21583 |
| 136 | Ga0068302_10045925 | 3300005071 | Bacteria | 1074 |
| 137 | Ga0103261_1000334 | 3300007083 | Unclassified | 17818 |
| 138 | Ga0123353_10460084 | 3300010167 | Unclassified | 1870 |
| 139 | Ga0123353_11325036 | 3300010167 | Bacteria | 933 |
| 140 | Ga0466657_060928 | 3300042582 | Bacteria | 1670 |
| 141 | Ga0466690_001114 | 3300042590 | Bacteria | 3280 |
| 142 | Ga0466696_497277 | 3300042596 | Unclassified | 1336 |
| 143 | Ga0466717_031836 | 3300042604 | Bacteria | 3221 |
| 144 | Ga0466721_095348 | 3300042608 | Bacteria | 7136 |
| 145 | Ga0466722_238713 | 3300042609 | Bacteria | 14338 |
| 146 | Ga0466715_065516 | 3300042616 | Bacteria | 11008 |
| 147 | Ga0466715_167506 | 3300042616 | Bacteria | 6342 |
| 148 | Ga0466723_233551 | 3300042618 | Bacteria | 9867 |
| 149 | Ga0466728_104537 | 3300042620 | Unclassified | 8041 |
| 150 | Ga0466697_066473 | 3300042611 | Bacteria | 18820 |
| 151 | Ga0466735_017760 | 3300042624 | Bacteria | 1112 |
| 152 | Ga0466709_045458 | 3300042648 | Unclassified | 5267 |
| 153 | Ga0466709_153009 | 3300042648 | Unclassified | 4060 |
| 154 | Ga0466727_056560 | 3300042655 | Bacteria | 3526 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01016 | Ribosomal_L27 | Ribosomal L27 protein | 2 | 81 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.