Protein Family IF08248
Metagenome
Isolate
184
Members
57
Samples
175
Scaffolds
166.23
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_161620|Ga0466726_161620_1288_1857
- Length
- 189 aa
- Sequence
- MKKQLKLYEHYKLKKRNIMKKIFLALGLLLGGFAFANAQKFALIDMEYLLKNIPSYETANEQLNQVSKKWQAEVDAKQTDIQNKYKNYQTEVVFLSEEMKTKRENEIVAAEKELQELRRKYFGSDGELFKKRESLIKPIQDEIYNAVKDVCDDKGYQLILDRASGNNIIFASPKIDISDDVLAKMGYSK
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.7%
Kalotermitidae
25.5%
Unclassified
12.7%
Rhinotermitidae
7.3%
Termopsidae
7.3%
Passalidae
5.5%
Blattidae
3.6%
Armadillidiidae
1.8%
Hodotermitidae
1.8%
Drosophilidae
1.8%
Taxonomy
Archaea
0
Bacteria
176
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 2 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 3 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 4 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 5 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 6 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 7 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 8 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 9 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 10 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 15 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 16 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 20 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 26 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 29 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300005299 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 1 gut | Metagenome | Drosophilidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 36 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 37 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 38 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 39 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 48 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 49 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 50 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 51 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_043093 | 3300042612 | Bacteria | 9025 |
| 2 | Ga0466714_033768 | 3300042603 | Bacteria | 2955 |
| 3 | Ga0466716_132536 | 3300042605 | Bacteria | 38589 |
| 4 | 2227654075 | 2225789004 | Bacteria | 1986 |
| 5 | IMNBL1DRAFT_c0025043 | 3300000062 | Bacteria | 2296 |
| 6 | IMNBL1DRAFT_c0047033 | 3300000062 | Bacteria | 1396 |
| 7 | JGI24696J40584_12953827 | 3300002834 | Bacteria | 2541 |
| 8 | Ga0466690_266154 | 3300042590 | Bacteria | 16703 |
| 9 | Ga0466694_386073 | 3300042594 | Bacteria | 3689 |
| 10 | Ga0466696_128148 | 3300042596 | Bacteria | 1184 |
| 11 | Ga0466735_007012 | 3300042624 | Bacteria | 9749 |
| 12 | Ga0466735_022093 | 3300042624 | Bacteria | 1416 |
| 13 | Ga0466703_007779 | 3300042636 | Bacteria | 9718 |
| 14 | Ga0466704_141798 | 3300042643 | Bacteria | 1717 |
| 15 | Ga0466704_228411 | 3300042643 | Bacteria | 3890 |
| 16 | Ga0466708_172971 | 3300042652 | Bacteria | 8554 |
| 17 | Ga0123355_10400538 | 3300009826 | Bacteria | 1770 |
| 18 | Ga0123354_10044772 | 3300010882 | Bacteria | 6782 |
| 19 | Ga0466715_539081 | 3300042616 | Bacteria | 22352 |
| 20 | Ga0466705_000434 | 3300042612 | Bacteria | 1166 |
| 21 | Ga0466733_054986 | 3300042659 | Bacteria | 147644 |
| 22 | Ga0466707_120817 | 3300042601 | Bacteria | 29196 |
| 23 | Ga0466707_402853 | 3300042601 | Bacteria | 16448 |
| 24 | Ga0466713_066392 | 3300042602 | Bacteria | 2747 |
| 25 | Ga0466713_120444 | 3300042602 | Bacteria | 5013 |
| 26 | Ga0466716_467442 | 3300042605 | Bacteria | 25909 |
| 27 | 2227066924 | 2225789003 | Bacteria | 3164 |
| 28 | IMNBL1DRAFT_c0003109 | 3300000062 | Bacteria | 10946 |
| 29 | IMNBL1DRAFT_c0003820 | 3300000062 | Bacteria | 9388 |
| 30 | IMNBL1DRAFT_c0006226 | 3300000062 | Bacteria | 6563 |
| 31 | Ga0068302_10688297 | 3300005071 | Bacteria | 908 |
| 32 | Ga0123357_10000375 | 3300009784 | Bacteria | 42298 |
| 33 | Ga0466657_388158 | 3300042582 | Bacteria | 5462 |
| 34 | Ga0466692_157293 | 3300042591 | Bacteria | 55644 |
| 35 | Ga0466703_123347 | 3300042636 | Bacteria | 1314 |
| 36 | Ga0466703_216149 | 3300042636 | Bacteria | 1515 |
| 37 | Ga0466703_266206 | 3300042636 | Bacteria | 2006 |
| 38 | Ga0466704_186888 | 3300042643 | Bacteria | 12934 |
| 39 | Ga0466727_294126 | 3300042655 | Bacteria | 6812 |
| 40 | Ga0123357_10463225 | 3300009784 | Bacteria | 1087 |
| 41 | Ga0123356_11987261 | 3300010049 | Bacteria | 725 |
| 42 | Ga0123356_12508332 | 3300010049 | Bacteria | 645 |
| 43 | Ga0466715_117755 | 3300042616 | Bacteria | 4378 |
| 44 | Ga0466729_185342 | 3300042621 | Bacteria | 1125 |
| 45 | Ga0466705_219816 | 3300042612 | Bacteria | 11106 |
| 46 | Ga0466732_050860 | 3300042656 | Bacteria | 1920 |
| 47 | Ga0466733_109595 | 3300042659 | Bacteria | 8758 |
| 48 | Ga0466701_055721 | 3300042598 | Bacteria | 17089 |
| 49 | Ga0466707_065865 | 3300042601 | Bacteria | 3433 |
| 50 | Ga0466714_168628 | 3300042603 | Bacteria | 36223 |
| 51 | Ga0466719_527620 | 3300042606 | Bacteria | 3348 |
| 52 | Ga0466722_148018 | 3300042609 | Bacteria | 2619 |
| 53 | 2227419713 | 2225789004 | Bacteria | 5629 |
| 54 | IMNBL1DRAFT_c0000748 | 3300000062 | Bacteria | 25790 |
| 55 | IMNBL1DRAFT_c0023137 | 3300000062 | Unclassified | 2442 |
| 56 | Ga0466691_115668 | 3300042593 | Bacteria | 14219 |
| 57 | Ga0466696_194073 | 3300042596 | Bacteria | 13847 |
| 58 | Ga0466734_100783 | 3300042623 | Bacteria | 1216 |
| 59 | Ga0466735_026200 | 3300042624 | Bacteria | 2932 |
| 60 | Ga0466703_055226 | 3300042636 | Bacteria | 7202 |
| 61 | Ga0466703_186435 | 3300042636 | Bacteria | 25415 |
| 62 | Ga0466704_098030 | 3300042643 | Bacteria | 25866 |
| 63 | Ga0466704_402414 | 3300042643 | Bacteria | 1312 |
| 64 | Ga0466727_235389 | 3300042655 | Bacteria | 27915 |
| 65 | Ga0123356_10600717 | 3300010049 | Bacteria | 1265 |
| 66 | Ga0123354_10000458 | 3300010882 | Bacteria | 40359 |
| 67 | Ga0466715_234297 | 3300042616 | Bacteria | 23273 |
| 68 | Ga0466715_612327 | 3300042616 | Bacteria | 14168 |
| 69 | Ga0466726_345273 | 3300042619 | Bacteria | 17044 |
| 70 | Ga0466705_380103 | 3300042612 | Bacteria | 6303 |
| 71 | Ga0466733_098937 | 3300042659 | Bacteria | 150442 |
| 72 | Ga0466700_058504 | 3300042600 | Bacteria | 32871 |
| 73 | Ga0466707_149125 | 3300042601 | Bacteria | 54451 |
| 74 | Ga0466707_241108 | 3300042601 | Bacteria | 10272 |
| 75 | Ga0466713_077002 | 3300042602 | Unclassified | 1408 |
| 76 | Ga0466722_245984 | 3300042609 | Bacteria | 2621 |
| 77 | IMNBL1DRAFT_c0001879 | 3300000062 | Bacteria | 15291 |
| 78 | Ga0466690_158849 | 3300042590 | Bacteria | 3700 |
| 79 | Ga0466690_185521 | 3300042590 | Bacteria | 30034 |
| 80 | Ga0466690_216745 | 3300042590 | Bacteria | 23549 |
| 81 | Ga0466692_118376 | 3300042591 | Bacteria | 10859 |
| 82 | Ga0466692_156027 | 3300042591 | Bacteria | 99798 |
| 83 | Ga0466735_012596 | 3300042624 | Bacteria | 7500 |
| 84 | Ga0466704_300754 | 3300042643 | Bacteria | 15840 |
| 85 | Ga0466704_603581 | 3300042643 | Bacteria | 10476 |
| 86 | Ga0466709_150615 | 3300042648 | Bacteria | 8322 |
| 87 | Ga0466727_012286 | 3300042655 | Unclassified | 2177 |
| 88 | Ga0466727_121999 | 3300042655 | Bacteria | 5144 |
| 89 | Ga0123357_10010391 | 3300009784 | Bacteria | 11836 |
| 90 | Ga0123356_10008869 | 3300010049 | Bacteria | 9954 |
| 91 | Ga0123356_10184502 | 3300010049 | Bacteria | 2111 |
| 92 | Ga0123354_10006042 | 3300010882 | Bacteria | 17852 |
| 93 | Ga0123354_10138272 | 3300010882 | Bacteria | 3031 |
| 94 | Ga0466723_001361 | 3300042618 | Bacteria | 10124 |
| 95 | Ga0466729_099483 | 3300042621 | Bacteria | 41214 |
| 96 | Ga0466705_179010 | 3300042612 | Bacteria | 13746 |
| 97 | Ga0466733_027547 | 3300042659 | Bacteria | 4185 |
| 98 | Ga0466733_100739 | 3300042659 | Bacteria | 15317 |
| 99 | Ga0466707_125055 | 3300042601 | Bacteria | 48281 |
| 100 | Ga0466707_149294 | 3300042601 | Bacteria | 10479 |
| 101 | Ga0466707_371061 | 3300042601 | Bacteria | 5489 |
| 102 | Ga0466719_522466 | 3300042606 | Bacteria | 12904 |
| 103 | 2227097468 | 2225789004 | Bacteria | 9705 |
| 104 | 2227100261 | 2225789004 | Bacteria | 9603 |
| 105 | JGI24696J40584_12958305 | 3300002834 | Bacteria | 4024 |
| 106 | Ga0466729_298838 | 3300042621 | Bacteria | 9069 |
| 107 | Ga0466704_106067 | 3300042643 | Bacteria | 5749 |
| 108 | Ga0466708_348735 | 3300042652 | Bacteria | 36830 |
| 109 | Ga0466727_182405 | 3300042655 | Bacteria | 2637 |
| 110 | Ga0466727_332161 | 3300042655 | Bacteria | 6469 |
| 111 | Ga0123357_10003925 | 3300009784 | Bacteria | 17272 |
| 112 | Ga0123357_10188816 | 3300009784 | Bacteria | 2382 |
| 113 | Ga0123356_11487719 | 3300010049 | Bacteria | 835 |
| 114 | Ga0123354_10023485 | 3300010882 | Bacteria | 9726 |
| 115 | Ga0466711_109799 | 3300042615 | Bacteria | 7548 |
| 116 | Ga0466726_241947 | 3300042619 | Bacteria | 2444 |
| 117 | Ga0466729_183964 | 3300042621 | Bacteria | 7155 |
| 118 | Ga0466705_052121 | 3300042612 | Bacteria | 3996 |
| 119 | Ga0466705_062816 | 3300042612 | Bacteria | 1476 |
| 120 | Ga0466701_039977 | 3300042598 | Bacteria | 63641 |
| 121 | Ga0466713_094780 | 3300042602 | Bacteria | 5332 |
| 122 | Ga0466714_028666 | 3300042603 | Bacteria | 89946 |
| 123 | Ga0466722_154451 | 3300042609 | Bacteria | 18589 |
| 124 | IMNBL1DRAFT_c0008496 | 3300000062 | Bacteria | 5219 |
| 125 | JGI24699J35502_11134117 | 3300002509 | Bacteria | 33021 |
| 126 | Ga0074146_1080796 | 3300005299 | Bacteria | 626 |
| 127 | Ga0160467_100079 | 3300012829 | Bacteria | 143692 |
| 128 | Ga0466696_488820 | 3300042596 | Bacteria | 4509 |
| 129 | Ga0466734_042351 | 3300042623 | Bacteria | 2098 |
| 130 | Ga0466735_069773 | 3300042624 | Bacteria | 2591 |
| 131 | Ga0466735_115958 | 3300042624 | Bacteria | 2820 |
| 132 | Ga0466703_306816 | 3300042636 | Bacteria | 6824 |
| 133 | Ga0466727_151598 | 3300042655 | Bacteria | 10939 |
| 134 | Ga0123356_11232450 | 3300010049 | Bacteria | 913 |
| 135 | Ga0466705_397833 | 3300042612 | Bacteria | 11678 |
| 136 | Ga0466723_197989 | 3300042618 | Bacteria | 2277 |
| 137 | Ga0466726_165433 | 3300042619 | Bacteria | 15218 |
| 138 | Ga0466697_066145 | 3300042611 | Bacteria | 1098 |
| 139 | Ga0466706_050770 | 3300042599 | Bacteria | 1617 |
| 140 | Ga0466719_422128 | 3300042606 | Bacteria | 2704 |
| 141 | 2227236340 | 2225789004 | Bacteria | 7303 |
| 142 | 2227250289 | 2225789004 | Bacteria | 1321 |
| 143 | JGI24702J35022_10209388 | 3300002462 | Bacteria | 1119 |
| 144 | JGI24696J40584_12959377 | 3300002834 | Bacteria | 5055 |
| 145 | Ga0068302_10031740 | 3300005071 | Bacteria | 4999 |
| 146 | Ga0466693_074215 | 3300042592 | Bacteria | 1612 |
| 147 | Ga0466696_231342 | 3300042596 | Bacteria | 20663 |
| 148 | Ga0466696_402623 | 3300042596 | Bacteria | 8383 |
| 149 | Ga0466730_043926 | 3300042625 | Bacteria | 5251 |
| 150 | Ga0466703_261353 | 3300042636 | Bacteria | 5465 |
| 151 | Ga0466704_444391 | 3300042643 | Unclassified | 2045 |
| 152 | Ga0466704_482235 | 3300042643 | Bacteria | 12517 |
| 153 | Ga0466709_316667 | 3300042648 | Bacteria | 8932 |
| 154 | Ga0466727_030490 | 3300042655 | Bacteria | 13925 |
| 155 | Ga0466727_154212 | 3300042655 | Bacteria | 9784 |
| 156 | Ga0123357_10029772 | 3300009784 | Bacteria | 7401 |
| 157 | Ga0123354_10332095 | 3300010882 | Unclassified | 1384 |
| 158 | Ga0123354_10373100 | 3300010882 | Bacteria | 1242 |
| 159 | Ga0466728_286887 | 3300042620 | Bacteria | 10655 |
| 160 | Ga0466707_184611 | 3300042601 | Bacteria | 10575 |
| 161 | Ga0466714_075340 | 3300042603 | Bacteria | 5032 |
| 162 | Ga0466716_064575 | 3300042605 | Bacteria | 8545 |
| 163 | Ga0466719_562841 | 3300042606 | Bacteria | 1297 |
| 164 | Ga0466697_039481 | 3300042611 | Bacteria | 2926 |
| 165 | IMNBL1DRAFT_c0000975 | 3300000062 | Bacteria | 22090 |
| 166 | JGI24702J35022_10075890 | 3300002462 | Unclassified | 1816 |
| 167 | Ga0265387_1013054 | 3300024582 | Bacteria | 1156 |
| 168 | Ga0466692_061204 | 3300042591 | Bacteria | 5151 |
| 169 | Ga0466692_186666 | 3300042591 | Unclassified | 1941 |
| 170 | Ga0466730_050517 | 3300042625 | Bacteria | 2216 |
| 171 | Ga0466703_095941 | 3300042636 | Bacteria | 10067 |
| 172 | Ga0466704_377215 | 3300042643 | Unclassified | 18321 |
| 173 | Ga0466709_309597 | 3300042648 | Bacteria | 40669 |
| 174 | Ga0466711_236714 | 3300042615 | Bacteria | 18403 |
| 175 | Ga0466726_161620 | 3300042619 | Bacteria | 2106 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03938 | OmpH | Outer membrane protein (OmpH-like) | 40 | 185 | 0.94 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03938 | GO:0051082 | unfolded protein binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.