Protein Family IF08196
Metagenome
Isolate
254
Members
65
Samples
248
Scaffolds
113.33
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_043307|Ga0466726_043307_6006_6395
- Length
- 129 aa
- Sequence
- MVNKKYIPERGDVVWLNFNPQMGHEQKGKRPAIVISPKEYNEKVNLGLFCPITSKEKNYPFEVKIKNEKIDGVVLSDQIKSLDWTKRGIDYIIKATEDEINEVLNKIGVLINRMPESAGAGRKALMAFG
Sample Types
Isolate
2.4%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.8%
Kalotermitidae
21.0%
Unclassified
8.1%
Rhinotermitidae
4.8%
Ixodidae
4.8%
Termopsidae
4.8%
Hodotermitidae
1.6%
Taxonomy
Archaea
3
Bacteria
209
Eukaryota
0
Viruses
0
Unclassified
42
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 23 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 2855972776 | Rickettsia colombianensi Adcor 2 | Isolate | Ixodidae |
| 31 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 32 | 8068887342 | Rickettsia asiatica Maytaro1284 | Isolate | Ixodidae |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 41 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 46 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 47 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 48 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 49 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 50 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 51 | 2597489904 | Rickettsia helvetica C9P9 | Isolate | Ixodidae |
| 52 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 53 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 54 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 60 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 61 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 62 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 63 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 64 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 65 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_026858 | 3300042590 | Unclassified | 2616 |
| 2 | Ga0466690_212976 | 3300042590 | Unclassified | 4838 |
| 3 | Ga0466690_347246 | 3300042590 | Unclassified | 1245 |
| 4 | Ga0466693_239545 | 3300042592 | Bacteria | 1682 |
| 5 | Ga0466691_019277 | 3300042593 | Bacteria | 10895 |
| 6 | Ga0466694_265507 | 3300042594 | Bacteria | 1610 |
| 7 | Ga0466701_041449 | 3300042598 | Bacteria | 1435 |
| 8 | Ga0466707_357235 | 3300042601 | Bacteria | 1757 |
| 9 | Ga0466716_003519 | 3300042605 | Bacteria | 9716 |
| 10 | Ga0466698_224442 | 3300042610 | Bacteria | 1657 |
| 11 | Ga0123356_12163799 | 3300010049 | Bacteria | 695 |
| 12 | Ga0123356_13230024 | 3300010049 | Bacteria | 567 |
| 13 | Ga0123353_10362064 | 3300010167 | Bacteria | 2179 |
| 14 | Ga0123353_11428144 | 3300010167 | Bacteria | 887 |
| 15 | Ga0123354_10552256 | 3300010882 | Bacteria | 868 |
| 16 | AustNasuHG_c1008659 | 3300000089 | Bacteria | 3599 |
| 17 | FAAS_10318012 | 3300001880 | Bacteria | 553 |
| 18 | FAAS_10724147 | 3300001880 | Bacteria | 505 |
| 19 | JGI24698J34947_10105513 | 3300002449 | Bacteria | 1256 |
| 20 | JGI24695J34938_10000875 | 3300002450 | Bacteria | 27805 |
| 21 | JGI24705J35276_11691274 | 3300002504 | Bacteria | 629 |
| 22 | JGI24696J40584_12832536 | 3300002834 | Unclassified | 934 |
| 23 | Ga0466715_013191 | 3300042616 | Bacteria | 8573 |
| 24 | Ga0466715_290479 | 3300042616 | Bacteria | 10306 |
| 25 | Ga0466715_419345 | 3300042616 | Bacteria | 1299 |
| 26 | Ga0466718_020707 | 3300042617 | Bacteria | 11227 |
| 27 | Ga0466726_029804 | 3300042619 | Unclassified | 1178 |
| 28 | Ga0466726_043307 | 3300042619 | Bacteria | 6502 |
| 29 | Ga0466726_164053 | 3300042619 | Bacteria | 8702 |
| 30 | Ga0466731_402792 | 3300042622 | Bacteria | 1260 |
| 31 | Ga0466705_106934 | 3300042612 | Bacteria | 1857 |
| 32 | Ga0466705_107047 | 3300042612 | Bacteria | 1552 |
| 33 | Ga0466690_188265 | 3300042590 | Bacteria | 1758 |
| 34 | Ga0466706_284783 | 3300042599 | Bacteria | 1301 |
| 35 | Ga0466717_047149 | 3300042604 | Bacteria | 1668 |
| 36 | Ga0123357_10619034 | 3300009784 | Bacteria | 820 |
| 37 | Ga0123356_10419086 | 3300010049 | Bacteria | 1481 |
| 38 | Ga0123356_10544457 | 3300010049 | Bacteria | 1321 |
| 39 | Ga0123356_12457407 | 3300010049 | Bacteria | 652 |
| 40 | Ga0123353_10069720 | 3300010167 | Bacteria | 5648 |
| 41 | Ga0123353_10569140 | 3300010167 | Unclassified | 1629 |
| 42 | JGI24698J34947_10000036 | 3300002449 | Bacteria | 37472 |
| 43 | JGI24702J35022_10245290 | 3300002462 | Unclassified | 1040 |
| 44 | JGI24702J35022_10616380 | 3300002462 | Bacteria | 672 |
| 45 | Ga0072940_1028411 | 3300005200 | Bacteria | 3894 |
| 46 | Ga0466705_479848 | 3300042612 | Bacteria | 9181 |
| 47 | Ga0466711_024789 | 3300042615 | Bacteria | 1273 |
| 48 | Ga0466718_140480 | 3300042617 | Bacteria | 2490 |
| 49 | Ga0466723_053411 | 3300042618 | Bacteria | 8209 |
| 50 | Ga0466726_258565 | 3300042619 | Bacteria | 1479 |
| 51 | Ga0466702_081014 | 3300042635 | Bacteria | 1005 |
| 52 | Ga0466702_085289 | 3300042635 | Bacteria | 1100 |
| 53 | Ga0466704_185959 | 3300042643 | Unclassified | 1243 |
| 54 | Ga0466704_607212 | 3300042643 | Bacteria | 7741 |
| 55 | Ga0466709_036991 | 3300042648 | Bacteria | 1351 |
| 56 | Ga0466709_122218 | 3300042648 | Bacteria | 4500 |
| 57 | Ga0466708_124494 | 3300042652 | Unclassified | 1151 |
| 58 | Ga0466732_418581 | 3300042656 | Bacteria | 31652 |
| 59 | Ga0466693_192438 | 3300042592 | Bacteria | 2951 |
| 60 | Ga0466691_078805 | 3300042593 | Bacteria | 1544 |
| 61 | Ga0466694_253434 | 3300042594 | Unclassified | 1612 |
| 62 | Ga0466706_180828 | 3300042599 | Bacteria | 8669 |
| 63 | Ga0466700_023828 | 3300042600 | Bacteria | 22000 |
| 64 | Ga0466707_153843 | 3300042601 | Bacteria | 1331 |
| 65 | Ga0466719_319544 | 3300042606 | Bacteria | 1300 |
| 66 | Ga0466719_440565 | 3300042606 | Unclassified | 2107 |
| 67 | Ga0466698_190487 | 3300042610 | Bacteria | 2089 |
| 68 | Ga0123357_10222074 | 3300009784 | Bacteria | 2093 |
| 69 | Ga0123355_10988367 | 3300009826 | Bacteria | 896 |
| 70 | Ga0123356_10679301 | 3300010049 | Bacteria | 1198 |
| 71 | Ga0123354_10569176 | 3300010882 | Bacteria | 845 |
| 72 | JGI24698J34947_10032890 | 3300002449 | Unclassified | 2722 |
| 73 | JGI24695J34938_10002133 | 3300002450 | Bacteria | 15451 |
| 74 | JGI24695J34938_10008704 | 3300002450 | Bacteria | 5757 |
| 75 | JGI24702J35022_10010113 | 3300002462 | Bacteria | 5281 |
| 76 | JGI24702J35022_10012008 | 3300002462 | Bacteria | 4823 |
| 77 | JGI24696J40584_12931372 | 3300002834 | Bacteria | 1484 |
| 78 | Ga0068305_10012601 | 3300005083 | Bacteria | 4367 |
| 79 | Ga0466712_267104 | 3300042614 | Bacteria | 1212 |
| 80 | Ga0466726_104654 | 3300042619 | Bacteria | 2321 |
| 81 | Ga0466726_132574 | 3300042619 | Bacteria | 1206 |
| 82 | Ga0466726_142072 | 3300042619 | Bacteria | 1224 |
| 83 | Ga0466726_245566 | 3300042619 | Bacteria | 1801 |
| 84 | Ga0466726_429900 | 3300042619 | Bacteria | 3739 |
| 85 | Ga0466728_069049 | 3300042620 | Bacteria | 1481 |
| 86 | Ga0466734_134896 | 3300042623 | Bacteria | 1748 |
| 87 | Ga0466735_151852 | 3300042624 | Bacteria | 2587 |
| 88 | Ga0466704_018860 | 3300042643 | Bacteria | 4168 |
| 89 | Ga0466704_108882 | 3300042643 | Bacteria | 12118 |
| 90 | Ga0466704_159244 | 3300042643 | Bacteria | 17169 |
| 91 | Ga0466704_246687 | 3300042643 | Unclassified | 1686 |
| 92 | Ga0466708_082346 | 3300042652 | Bacteria | 6789 |
| 93 | Ga0466708_097779 | 3300042652 | Unclassified | 1395 |
| 94 | Ga0466708_251487 | 3300042652 | Bacteria | 1403 |
| 95 | Ga0466697_223098 | 3300042611 | Bacteria | 1031 |
| 96 | Ga0466732_100274 | 3300042656 | Bacteria | 19549 |
| 97 | Ga0466690_018834 | 3300042590 | Bacteria | 4294 |
| 98 | Ga0466691_031678 | 3300042593 | Bacteria | 5013 |
| 99 | Ga0466691_066660 | 3300042593 | Bacteria | 2301 |
| 100 | Ga0466694_058297 | 3300042594 | Bacteria | 1291 |
| 101 | Ga0466699_214726 | 3300042597 | Bacteria | 4592 |
| 102 | Ga0466722_183946 | 3300042609 | Bacteria | 1238 |
| 103 | Ga0123357_10352192 | 3300009784 | Bacteria | 1407 |
| 104 | Ga0123356_10301386 | 3300010049 | Bacteria | 1708 |
| 105 | Ga0123353_11659010 | 3300010167 | Bacteria | 803 |
| 106 | Ga0123353_11836147 | 3300010167 | Bacteria | 751 |
| 107 | JGI24698J34947_10125445 | 3300002449 | Bacteria | 1107 |
| 108 | JGI24695J34938_10220497 | 3300002450 | Unclassified | 796 |
| 109 | JGI24695J34938_10229921 | 3300002450 | Bacteria | 781 |
| 110 | JGI24703J35330_11213784 | 3300002501 | Bacteria | 772 |
| 111 | JGI24699J35502_10371815 | 3300002509 | Unclassified | 550 |
| 112 | Ga0466712_019237 | 3300042614 | Bacteria | 15860 |
| 113 | Ga0466715_495296 | 3300042616 | Unclassified | 1017 |
| 114 | Ga0466718_021447 | 3300042617 | Bacteria | 1565 |
| 115 | Ga0466718_164110 | 3300042617 | Bacteria | 8077 |
| 116 | Ga0466718_166056 | 3300042617 | Bacteria | 1635 |
| 117 | Ga0466735_235447 | 3300042624 | Bacteria | 2382 |
| 118 | Ga0466704_318620 | 3300042643 | Unclassified | 4419 |
| 119 | Ga0466704_500100 | 3300042643 | Bacteria | 3459 |
| 120 | Ga0466727_034672 | 3300042655 | Bacteria | 3873 |
| 121 | Ga0466727_143749 | 3300042655 | Bacteria | 5990 |
| 122 | Ga0466705_025285 | 3300042612 | Bacteria | 2541 |
| 123 | Ga0466705_040539 | 3300042612 | Unclassified | 1829 |
| 124 | Ga0466705_140155 | 3300042612 | Bacteria | 1504 |
| 125 | Ga0466705_175936 | 3300042612 | Unclassified | 9180 |
| 126 | Ga0264413_115985 | 3300024493 | Bacteria | 4088 |
| 127 | Ga0264413_121285 | 3300024493 | Bacteria | 1934 |
| 128 | Ga0466657_401992 | 3300042582 | Bacteria | 1011 |
| 129 | Ga0466690_065834 | 3300042590 | Bacteria | 1565 |
| 130 | Ga0466690_107419 | 3300042590 | Bacteria | 3369 |
| 131 | Ga0466694_163004 | 3300042594 | Bacteria | 1388 |
| 132 | Ga0466719_004078 | 3300042606 | Bacteria | 6220 |
| 133 | Ga0123356_12492402 | 3300010049 | Bacteria | 647 |
| 134 | Ga0123353_10499617 | 3300010167 | Bacteria | 1773 |
| 135 | Ga0123353_11055025 | 3300010167 | Bacteria | 1085 |
| 136 | Ga0123353_11387098 | 3300010167 | Bacteria | 905 |
| 137 | AustNasuHG_c1006436 | 3300000089 | Bacteria | 4191 |
| 138 | JGI24698J34947_10076487 | 3300002449 | Bacteria | 1587 |
| 139 | JGI24695J34938_10008423 | 3300002450 | Unclassified | 5880 |
| 140 | JGI24695J34938_10011243 | 3300002450 | Unclassified | 4833 |
| 141 | JGI24695J34938_10021082 | 3300002450 | Bacteria | 3194 |
| 142 | JGI24695J34938_10115476 | 3300002450 | Bacteria | 1093 |
| 143 | JGI24702J35022_11024744 | 3300002462 | Bacteria | 513 |
| 144 | Ga0466712_008514 | 3300042614 | Bacteria | 4509 |
| 145 | Ga0466712_050431 | 3300042614 | Bacteria | 1206 |
| 146 | Ga0466723_307987 | 3300042618 | Bacteria | 8149 |
| 147 | Ga0466726_352425 | 3300042619 | Unclassified | 1193 |
| 148 | Ga0466731_161457 | 3300042622 | Unclassified | 1086 |
| 149 | Ga0466703_147954 | 3300042636 | Bacteria | 4369 |
| 150 | Ga0466704_342333 | 3300042643 | Unclassified | 5865 |
| 151 | Ga0466704_412847 | 3300042643 | Bacteria | 3489 |
| 152 | Ga0466705_328291 | 3300042612 | Bacteria | 1317 |
| 153 | Ga0466732_130996 | 3300042656 | Bacteria | 3898 |
| 154 | Ga0466656_130269 | 3300042550 | Bacteria | 1327 |
| 155 | Ga0466690_091250 | 3300042590 | Bacteria | 2388 |
| 156 | Ga0466694_206862 | 3300042594 | Bacteria | 4816 |
| 157 | Ga0466707_201360 | 3300042601 | Bacteria | 1062 |
| 158 | Ga0466717_188422 | 3300042604 | Bacteria | 1868 |
| 159 | Ga0466717_224651 | 3300042604 | Bacteria | 2857 |
| 160 | Ga0466719_096773 | 3300042606 | Unclassified | 1207 |
| 161 | Ga0466720_041015 | 3300042607 | Bacteria | 2583 |
| 162 | Ga0466721_195254 | 3300042608 | Bacteria | 1096 |
| 163 | Ga0466722_110392 | 3300042609 | Bacteria | 11274 |
| 164 | Ga0466698_010600 | 3300042610 | Bacteria | 1251 |
| 165 | Ga0123355_10031991 | 3300009826 | Bacteria | 8539 |
| 166 | Ga0123356_11301681 | 3300010049 | Bacteria | 890 |
| 167 | Ga0123354_10598675 | 3300010882 | Bacteria | 809 |
| 168 | JGI24698J34947_10050277 | 3300002449 | Bacteria | 2103 |
| 169 | JGI24695J34938_10044160 | 3300002450 | Bacteria | 1984 |
| 170 | JGI24695J34938_10111712 | 3300002450 | Bacteria | 1113 |
| 171 | Ga0072941_1046244 | 3300005201 | Bacteria | 4886 |
| 172 | Ga0072941_1046501 | 3300005201 | Bacteria | 1921 |
| 173 | Ga0466705_412504 | 3300042612 | Bacteria | 25058 |
| 174 | Ga0466712_076033 | 3300042614 | Unclassified | 18080 |
| 175 | Ga0466715_008575 | 3300042616 | Bacteria | 1927 |
| 176 | Ga0466718_162365 | 3300042617 | Bacteria | 1334 |
| 177 | Ga0466726_181579 | 3300042619 | Unclassified | 1155 |
| 178 | Ga0466728_055620 | 3300042620 | Bacteria | 3086 |
| 179 | Ga0466728_320344 | 3300042620 | Unclassified | 1048 |
| 180 | Ga0466704_026353 | 3300042643 | Bacteria | 13030 |
| 181 | Ga0466704_204714 | 3300042643 | Bacteria | 18636 |
| 182 | Ga0466704_251305 | 3300042643 | Unclassified | 3427 |
| 183 | Ga0466709_282616 | 3300042648 | Bacteria | 3357 |
| 184 | Ga0466708_323070 | 3300042652 | Bacteria | 2641 |
| 185 | Ga0466705_199186 | 3300042612 | Archaea | 7579 |
| 186 | Ga0456237_0012428 | 3300041968 | Bacteria | 1231 |
| 187 | Ga0466690_172625 | 3300042590 | Bacteria | 2146 |
| 188 | Ga0466694_109314 | 3300042594 | Bacteria | 1434 |
| 189 | Ga0466706_116710 | 3300042599 | Bacteria | 1629 |
| 190 | Ga0466700_110799 | 3300042600 | Bacteria | 9129 |
| 191 | Ga0466700_390976 | 3300042600 | Bacteria | 112705 |
| 192 | Ga0466707_084197 | 3300042601 | Bacteria | 1056 |
| 193 | Ga0466707_252749 | 3300042601 | Bacteria | 3321 |
| 194 | Ga0466720_112769 | 3300042607 | Bacteria | 14523 |
| 195 | Ga0123355_11708093 | 3300009826 | Bacteria | 599 |
| 196 | AustNasuHG_c1046778 | 3300000089 | Unclassified | 972 |
| 197 | JGI24698J34947_10136467 | 3300002449 | Bacteria | 1040 |
| 198 | Ga0072941_1018114 | 3300005201 | Bacteria | 3057 |
| 199 | Ga0072941_1018346 | 3300005201 | Unclassified | 24694 |
| 200 | Ga0072941_1058016 | 3300005201 | Bacteria | 1720 |
| 201 | Ga0466705_498415 | 3300042612 | Bacteria | 2282 |
| 202 | Ga0466718_020702 | 3300042617 | Bacteria | 14077 |
| 203 | Ga0466726_072351 | 3300042619 | Bacteria | 2692 |
| 204 | Ga0466728_181376 | 3300042620 | Bacteria | 2140 |
| 205 | Ga0466731_046460 | 3300042622 | Bacteria | 1916 |
| 206 | Ga0466731_344139 | 3300042622 | Bacteria | 1057 |
| 207 | Ga0466735_088558 | 3300042624 | Bacteria | 1111 |
| 208 | Ga0466735_106569 | 3300042624 | Bacteria | 1340 |
| 209 | Ga0466704_257900 | 3300042643 | Bacteria | 14172 |
| 210 | Ga0466704_296298 | 3300042643 | Bacteria | 1484 |
| 211 | Ga0466708_408774 | 3300042652 | Bacteria | 1560 |
| 212 | Ga0466727_314663 | 3300042655 | Unclassified | 1088 |
| 213 | Ga0466727_321723 | 3300042655 | Bacteria | 5248 |
| 214 | Ga0466705_046542 | 3300042612 | Unclassified | 1561 |
| 215 | Ga0466705_082127 | 3300042612 | Bacteria | 3177 |
| 216 | Ga0466690_377283 | 3300042590 | Bacteria | 1022 |
| 217 | Ga0466692_171489 | 3300042591 | Bacteria | 7374 |
| 218 | Ga0466694_350648 | 3300042594 | Bacteria | 1428 |
| 219 | Ga0466694_352524 | 3300042594 | Bacteria | 1623 |
| 220 | Ga0466695_043226 | 3300042595 | Bacteria | 1181 |
| 221 | Ga0466699_095925 | 3300042597 | Bacteria | 4618 |
| 222 | Ga0466700_302770 | 3300042600 | Bacteria | 1395 |
| 223 | Ga0466707_217195 | 3300042601 | Bacteria | 1119 |
| 224 | Ga0466717_100533 | 3300042604 | Bacteria | 1438 |
| 225 | Ga0466719_113138 | 3300042606 | Unclassified | 1164 |
| 226 | Ga0466721_174989 | 3300042608 | Bacteria | 226195 |
| 227 | Ga0123356_10926355 | 3300010049 | Bacteria | 1042 |
| 228 | Ga0123353_10279119 | 3300010167 | Bacteria | 2567 |
| 229 | Ga0123353_12370155 | 3300010167 | Bacteria | 636 |
| 230 | AustNasuHG_c1010081 | 3300000089 | Bacteria | 3302 |
| 231 | JGI24695J34938_10043832 | 3300002450 | Unclassified | 1993 |
| 232 | JGI24695J34938_10121129 | 3300002450 | Unclassified | 1065 |
| 233 | Ga0466710_378374 | 3300042613 | Bacteria | 1398 |
| 234 | Ga0466712_314978 | 3300042614 | Bacteria | 1483 |
| 235 | Ga0466711_376238 | 3300042615 | Bacteria | 16015 |
| 236 | Ga0466715_319404 | 3300042616 | Unclassified | 2259 |
| 237 | Ga0466718_066837 | 3300042617 | Archaea | 1308 |
| 238 | Ga0466726_171810 | 3300042619 | Bacteria | 2786 |
| 239 | Ga0466726_210528 | 3300042619 | Unclassified | 1438 |
| 240 | Ga0466726_310571 | 3300042619 | Archaea | 1564 |
| 241 | Ga0466731_103799 | 3300042622 | Bacteria | 1100 |
| 242 | Ga0466708_109925 | 3300042652 | Bacteria | 8426 |
| 243 | Ga0466708_113796 | 3300042652 | Bacteria | 2448 |
| 244 | Ga0466708_128195 | 3300042652 | Unclassified | 1533 |
| 245 | Ga0466708_199842 | 3300042652 | Unclassified | 1207 |
| 246 | Ga0466708_215517 | 3300042652 | Unclassified | 3625 |
| 247 | Ga0466727_136003 | 3300042655 | Bacteria | 5583 |
| 248 | Ga0466727_146701 | 3300042655 | Bacteria | 1779 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02452 | PemK_toxin | PemK-like, MazF-like toxin of type II toxin-antitoxin system | 9 | 109 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02452 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.