Protein Family IF08104
Metagenome
Isolate
240
Members
51
Samples
232
Scaffolds
475.65
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_183954|Ga0466723_183954_4900_6336
- Length
- 461 aa
- Sequence
- MFEEALSYDDVLLLPGHSEILPRDCDVRTTLCGALRLNVPVISAAMDTVTEEKFAIAIALEGGTGVIHRNLSPEEQARQVGNVKRYLNWIIDSPVTVGEDALVRDVKSLKEKFQVSGMPVLNSEGRLVGIITSRDLRFCRDDSLPVKDVMTRNPVVVQGEPSVSGAREKFDKHRIEKLPVTDAEGRLTGLITVKDMEKHDRFPRADFEQRLPLLKNVKVDYVVLDTAHGDTKNVMEAVRKIRKRFGIPVIGGNVASREGTRRLIEAGADAVKVGIGPGSICTTRIVAGIGVPQFTAVWECAGEAAKSGIPVIADGGIKFSGDITKAIGAGADMVMIGNLFAGLKEAPGNEIIFDGRIYKEYRGMGSLGAINDGAGDRYQLTKDEEPVPEGIEGRVPYKGELRSYLNQLVSGLRKGMGYCGCKNIEELKRYRKFVKITAAGFKESHAHDVTITQEAPNYSRS
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.3%
Kalotermitidae
27.5%
Unclassified
19.6%
Rhinotermitidae
7.8%
Termopsidae
5.9%
Hodotermitidae
2.0%
Blaberidae
2.0%
Taxonomy
Archaea
0
Bacteria
218
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 28 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 29 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 30 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 31 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 32 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 33 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_057988 | 3300042612 | Unclassified | 2870 |
| 2 | Ga0466705_086245 | 3300042612 | Unclassified | 1763 |
| 3 | Ga0466705_104460 | 3300042612 | Bacteria | 2682 |
| 4 | Ga0466705_159269 | 3300042612 | Bacteria | 4351 |
| 5 | Ga0466705_260214 | 3300042612 | Bacteria | 4336 |
| 6 | Ga0123353_10205569 | 3300010167 | Unclassified | 3093 |
| 7 | Ga0466716_201290 | 3300042605 | Bacteria | 10412 |
| 8 | Ga0466720_012390 | 3300042607 | Bacteria | 4685 |
| 9 | Ga0466722_222964 | 3300042609 | Bacteria | 20370 |
| 10 | Ga0456237_0001572 | 3300041968 | Bacteria | 3647 |
| 11 | Ga0466690_270102 | 3300042590 | Bacteria | 9900 |
| 12 | Ga0466690_286042 | 3300042590 | Bacteria | 4151 |
| 13 | Ga0466691_011266 | 3300042593 | Bacteria | 4692 |
| 14 | Ga0466696_273947 | 3300042596 | Bacteria | 15532 |
| 15 | Ga0466699_016990 | 3300042597 | Bacteria | 7604 |
| 16 | AustNasuHG_c1000930 | 3300000089 | Bacteria | 10577 |
| 17 | JGI24702J35022_10006689 | 3300002462 | Bacteria | 6650 |
| 18 | Ga0466711_048011 | 3300042615 | Bacteria | 9509 |
| 19 | Ga0466711_163973 | 3300042615 | Bacteria | 5208 |
| 20 | Ga0466711_294734 | 3300042615 | Bacteria | 19689 |
| 21 | Ga0466715_075991 | 3300042616 | Bacteria | 14077 |
| 22 | Ga0466715_408251 | 3300042616 | Bacteria | 8705 |
| 23 | Ga0466723_036199 | 3300042618 | Bacteria | 24106 |
| 24 | Ga0466723_092273 | 3300042618 | Bacteria | 3082 |
| 25 | Ga0466723_263331 | 3300042618 | Bacteria | 6828 |
| 26 | Ga0466723_310211 | 3300042618 | Bacteria | 9194 |
| 27 | Ga0466726_100680 | 3300042619 | Bacteria | 5550 |
| 28 | Ga0466726_177957 | 3300042619 | Bacteria | 16745 |
| 29 | Ga0466703_028972 | 3300042636 | Bacteria | 5552 |
| 30 | Ga0466704_140159 | 3300042643 | Bacteria | 23373 |
| 31 | Ga0466709_392983 | 3300042648 | Bacteria | 3038 |
| 32 | Ga0466708_127532 | 3300042652 | Bacteria | 8006 |
| 33 | Ga0466732_231735 | 3300042656 | Bacteria | 1579 |
| 34 | Ga0123355_10016969 | 3300009826 | Bacteria | 11491 |
| 35 | Ga0466716_092401 | 3300042605 | Bacteria | 4835 |
| 36 | Ga0466719_044531 | 3300042606 | Bacteria | 7082 |
| 37 | Ga0466719_059752 | 3300042606 | Bacteria | 19078 |
| 38 | Ga0466719_070963 | 3300042606 | Bacteria | 7007 |
| 39 | Ga0466719_126290 | 3300042606 | Bacteria | 14763 |
| 40 | Ga0466719_128679 | 3300042606 | Bacteria | 4630 |
| 41 | Ga0466719_491825 | 3300042606 | Bacteria | 5378 |
| 42 | Ga0466720_020932 | 3300042607 | Bacteria | 8983 |
| 43 | Ga0466720_152963 | 3300042607 | Unclassified | 3095 |
| 44 | Ga0466722_154505 | 3300042609 | Bacteria | 9599 |
| 45 | Ga0456237_0002972 | 3300041968 | Bacteria | 2755 |
| 46 | Ga0466690_005348 | 3300042590 | Bacteria | 17626 |
| 47 | Ga0466690_182665 | 3300042590 | Bacteria | 9441 |
| 48 | Ga0466692_011152 | 3300042591 | Bacteria | 10393 |
| 49 | Ga0466692_122932 | 3300042591 | Bacteria | 14135 |
| 50 | Ga0466691_049961 | 3300042593 | Bacteria | 3743 |
| 51 | Ga0466696_005818 | 3300042596 | Bacteria | 27640 |
| 52 | Ga0466696_071528 | 3300042596 | Bacteria | 16884 |
| 53 | Ga0466696_097603 | 3300042596 | Bacteria | 8107 |
| 54 | Ga0466712_202636 | 3300042614 | Bacteria | 10117 |
| 55 | Ga0466711_028445 | 3300042615 | Bacteria | 14670 |
| 56 | Ga0466711_076850 | 3300042615 | Bacteria | 18451 |
| 57 | Ga0466711_364950 | 3300042615 | Bacteria | 8371 |
| 58 | Ga0466715_334917 | 3300042616 | Bacteria | 12590 |
| 59 | Ga0466715_498542 | 3300042616 | Bacteria | 3097 |
| 60 | Ga0466718_022413 | 3300042617 | Bacteria | 8106 |
| 61 | Ga0466718_031913 | 3300042617 | Bacteria | 14989 |
| 62 | Ga0466718_139620 | 3300042617 | Bacteria | 2449 |
| 63 | Ga0466723_022695 | 3300042618 | Bacteria | 15683 |
| 64 | Ga0466726_164932 | 3300042619 | Bacteria | 2153 |
| 65 | Ga0466703_037865 | 3300042636 | Unclassified | 4261 |
| 66 | Ga0466703_272773 | 3300042636 | Bacteria | 4353 |
| 67 | Ga0466704_312082 | 3300042643 | Bacteria | 3552 |
| 68 | Ga0466704_457484 | 3300042643 | Bacteria | 17915 |
| 69 | Ga0466709_160100 | 3300042648 | Bacteria | 9896 |
| 70 | Ga0466708_160968 | 3300042652 | Bacteria | 3548 |
| 71 | Ga0466727_077429 | 3300042655 | Bacteria | 6873 |
| 72 | Ga0466727_147857 | 3300042655 | Bacteria | 5349 |
| 73 | Ga0466705_017521 | 3300042612 | Bacteria | 8187 |
| 74 | Ga0466717_018769 | 3300042604 | Bacteria | 1745 |
| 75 | Ga0466719_085722 | 3300042606 | Bacteria | 3004 |
| 76 | Ga0466720_009018 | 3300042607 | Unclassified | 5797 |
| 77 | Ga0466720_044787 | 3300042607 | Unclassified | 5999 |
| 78 | Ga0466722_086274 | 3300042609 | Bacteria | 12697 |
| 79 | Ga0466692_057609 | 3300042591 | Bacteria | 2518 |
| 80 | Ga0466692_133640 | 3300042591 | Bacteria | 8995 |
| 81 | Ga0466691_037286 | 3300042593 | Bacteria | 4656 |
| 82 | Ga0466691_094938 | 3300042593 | Bacteria | 5668 |
| 83 | Ga0466696_218438 | 3300042596 | Bacteria | 4907 |
| 84 | Ga0466699_111547 | 3300042597 | Unclassified | 3125 |
| 85 | Ga0466699_389560 | 3300042597 | Bacteria | 2576 |
| 86 | Ga0068305_10001083 | 3300005083 | Bacteria | 23427 |
| 87 | Ga0074263_108853 | 3300005485 | Bacteria | 2356 |
| 88 | Ga0466723_056281 | 3300042618 | Bacteria | 5284 |
| 89 | Ga0466723_092072 | 3300042618 | Bacteria | 3161 |
| 90 | Ga0466723_140445 | 3300042618 | Bacteria | 6484 |
| 91 | Ga0466723_274141 | 3300042618 | Bacteria | 5672 |
| 92 | Ga0466728_427592 | 3300042620 | Unclassified | 2596 |
| 93 | Ga0466704_326271 | 3300042643 | Bacteria | 5313 |
| 94 | Ga0466704_532138 | 3300042643 | Bacteria | 6381 |
| 95 | Ga0466709_019570 | 3300042648 | Bacteria | 4591 |
| 96 | Ga0466708_238777 | 3300042652 | Bacteria | 13415 |
| 97 | Ga0466727_211287 | 3300042655 | Bacteria | 1523 |
| 98 | Ga0466705_185102 | 3300042612 | Bacteria | 3641 |
| 99 | Ga0466719_013057 | 3300042606 | Bacteria | 9078 |
| 100 | Ga0466690_356187 | 3300042590 | Bacteria | 3336 |
| 101 | Ga0466691_172561 | 3300042593 | Bacteria | 4430 |
| 102 | Ga0466691_190195 | 3300042593 | Bacteria | 4286 |
| 103 | Ga0466696_015539 | 3300042596 | Bacteria | 3722 |
| 104 | AustNasuHG_c1011172 | 3300000089 | Bacteria | 3115 |
| 105 | AustNasuHG_c1017164 | 3300000089 | Bacteria | 2411 |
| 106 | Ga0466711_137470 | 3300042615 | Bacteria | 10732 |
| 107 | Ga0466715_017244 | 3300042616 | Bacteria | 39122 |
| 108 | Ga0466715_028200 | 3300042616 | Bacteria | 10144 |
| 109 | Ga0466715_337385 | 3300042616 | Bacteria | 28368 |
| 110 | Ga0466715_637404 | 3300042616 | Bacteria | 9383 |
| 111 | Ga0466728_047521 | 3300042620 | Bacteria | 4098 |
| 112 | Ga0466728_241715 | 3300042620 | Bacteria | 7273 |
| 113 | Ga0466703_199972 | 3300042636 | Bacteria | 18432 |
| 114 | Ga0466703_207923 | 3300042636 | Bacteria | 3355 |
| 115 | Ga0466704_025066 | 3300042643 | Unclassified | 3411 |
| 116 | Ga0466704_190609 | 3300042643 | Bacteria | 6367 |
| 117 | Ga0466709_019248 | 3300042648 | Bacteria | 11979 |
| 118 | Ga0466708_030637 | 3300042652 | Bacteria | 19599 |
| 119 | Ga0466708_170781 | 3300042652 | Bacteria | 9680 |
| 120 | Ga0123356_10110939 | 3300010049 | Bacteria | 2649 |
| 121 | Ga0123354_10224437 | 3300010882 | Bacteria | 1985 |
| 122 | Ga0466713_111815 | 3300042602 | Bacteria | 2006 |
| 123 | Ga0466719_551588 | 3300042606 | Bacteria | 4285 |
| 124 | Ga0466722_175883 | 3300042609 | Bacteria | 14011 |
| 125 | Ga0466722_265120 | 3300042609 | Bacteria | 1877 |
| 126 | Ga0466690_185048 | 3300042590 | Unclassified | 4877 |
| 127 | Ga0466691_025653 | 3300042593 | Bacteria | 20181 |
| 128 | JGI24698J34947_10016722 | 3300002449 | Bacteria | 3980 |
| 129 | JGI24698J34947_10062540 | 3300002449 | Unclassified | 1827 |
| 130 | Ga0466712_129327 | 3300042614 | Bacteria | 10746 |
| 131 | Ga0466712_181455 | 3300042614 | Bacteria | 1620 |
| 132 | Ga0466715_498820 | 3300042616 | Bacteria | 3051 |
| 133 | Ga0466718_155848 | 3300042617 | Bacteria | 7172 |
| 134 | Ga0466723_183954 | 3300042618 | Bacteria | 6652 |
| 135 | Ga0466723_272050 | 3300042618 | Bacteria | 5619 |
| 136 | Ga0466726_406595 | 3300042619 | Bacteria | 4700 |
| 137 | Ga0466726_472068 | 3300042619 | Bacteria | 53187 |
| 138 | Ga0466703_005691 | 3300042636 | Bacteria | 3652 |
| 139 | Ga0466703_082097 | 3300042636 | Bacteria | 5778 |
| 140 | Ga0466703_303354 | 3300042636 | Bacteria | 59593 |
| 141 | Ga0466709_018196 | 3300042648 | Bacteria | 3175 |
| 142 | Ga0466708_179840 | 3300042652 | Bacteria | 28624 |
| 143 | Ga0466727_304784 | 3300042655 | Bacteria | 1478 |
| 144 | Ga0466705_093071 | 3300042612 | Bacteria | 7096 |
| 145 | Ga0466733_087939 | 3300042659 | Bacteria | 4042 |
| 146 | Ga0466733_106142 | 3300042659 | Bacteria | 10504 |
| 147 | Ga0123353_10148960 | 3300010167 | Bacteria | 3739 |
| 148 | Ga0466716_254094 | 3300042605 | Bacteria | 4243 |
| 149 | Ga0466716_339591 | 3300042605 | Bacteria | 5498 |
| 150 | Ga0466719_187827 | 3300042606 | Bacteria | 4515 |
| 151 | Ga0466720_044345 | 3300042607 | Bacteria | 4904 |
| 152 | Ga0466720_209844 | 3300042607 | Bacteria | 24188 |
| 153 | Ga0466722_187158 | 3300042609 | Bacteria | 11331 |
| 154 | Ga0466722_191869 | 3300042609 | Bacteria | 6897 |
| 155 | Ga0466722_223987 | 3300042609 | Bacteria | 9516 |
| 156 | Ga0466722_243957 | 3300042609 | Bacteria | 3525 |
| 157 | Ga0466693_353122 | 3300042592 | Bacteria | 2089 |
| 158 | Ga0466691_095697 | 3300042593 | Bacteria | 3329 |
| 159 | Ga0466691_105805 | 3300042593 | Bacteria | 8543 |
| 160 | Ga0466691_128234 | 3300042593 | Bacteria | 4019 |
| 161 | Ga0466691_147028 | 3300042593 | Bacteria | 14581 |
| 162 | Ga0466696_017879 | 3300042596 | Bacteria | 11346 |
| 163 | Ga0466696_288965 | 3300042596 | Bacteria | 2786 |
| 164 | JGI24700J35501_10930330 | 3300002508 | Bacteria | 13075 |
| 165 | Ga0466712_049786 | 3300042614 | Bacteria | 9773 |
| 166 | Ga0466712_151172 | 3300042614 | Bacteria | 5328 |
| 167 | Ga0466715_013386 | 3300042616 | Bacteria | 3206 |
| 168 | Ga0466715_037085 | 3300042616 | Bacteria | 4055 |
| 169 | Ga0466715_059331 | 3300042616 | Bacteria | 9132 |
| 170 | Ga0466715_349603 | 3300042616 | Unclassified | 5633 |
| 171 | Ga0466723_159008 | 3300042618 | Bacteria | 56322 |
| 172 | Ga0466726_187217 | 3300042619 | Bacteria | 2996 |
| 173 | Ga0466729_084385 | 3300042621 | Bacteria | 3403 |
| 174 | Ga0466735_098886 | 3300042624 | Bacteria | 10381 |
| 175 | Ga0466703_224292 | 3300042636 | Bacteria | 7915 |
| 176 | Ga0466703_358780 | 3300042636 | Bacteria | 3415 |
| 177 | Ga0466704_220972 | 3300042643 | Unclassified | 2372 |
| 178 | Ga0466704_254801 | 3300042643 | Bacteria | 10052 |
| 179 | Ga0466709_074784 | 3300042648 | Bacteria | 7260 |
| 180 | Ga0466709_297537 | 3300042648 | Bacteria | 19155 |
| 181 | Ga0466708_040230 | 3300042652 | Bacteria | 2106 |
| 182 | Ga0466708_151255 | 3300042652 | Bacteria | 7070 |
| 183 | Ga0466708_285658 | 3300042652 | Bacteria | 58408 |
| 184 | Ga0466708_348891 | 3300042652 | Bacteria | 3986 |
| 185 | Ga0466727_114339 | 3300042655 | Bacteria | 2093 |
| 186 | Ga0466705_132894 | 3300042612 | Bacteria | 4259 |
| 187 | Ga0466732_163532 | 3300042656 | Unclassified | 6808 |
| 188 | Ga0466706_121773 | 3300042599 | Bacteria | 3656 |
| 189 | Ga0466713_026543 | 3300042602 | Bacteria | 9552 |
| 190 | Ga0466716_176265 | 3300042605 | Bacteria | 3644 |
| 191 | Ga0466722_050071 | 3300042609 | Bacteria | 4570 |
| 192 | Ga0466693_008000 | 3300042592 | Bacteria | 2086 |
| 193 | Ga0466691_052677 | 3300042593 | Bacteria | 5931 |
| 194 | AustNasuHG_c1003296 | 3300000089 | Bacteria | 5828 |
| 195 | JGI24698J34947_10025604 | 3300002449 | Unclassified | 3140 |
| 196 | Ga0074263_110646 | 3300005485 | Bacteria | 4448 |
| 197 | Ga0466715_139098 | 3300042616 | Bacteria | 9207 |
| 198 | Ga0466715_419993 | 3300042616 | Bacteria | 10202 |
| 199 | Ga0466703_392235 | 3300042636 | Bacteria | 11647 |
| 200 | Ga0466704_058707 | 3300042643 | Unclassified | 3426 |
| 201 | Ga0466704_592366 | 3300042643 | Bacteria | 5767 |
| 202 | Ga0466708_227779 | 3300042652 | Unclassified | 2152 |
| 203 | Ga0466727_146685 | 3300042655 | Bacteria | 12131 |
| 204 | Ga0466705_011525 | 3300042612 | Unclassified | 4302 |
| 205 | Ga0466705_064073 | 3300042612 | Bacteria | 7273 |
| 206 | Ga0123356_10040224 | 3300010049 | Bacteria | 4356 |
| 207 | Ga0123353_10441554 | 3300010167 | Bacteria | 1919 |
| 208 | Ga0466707_189457 | 3300042601 | Bacteria | 1622 |
| 209 | Ga0466716_001631 | 3300042605 | Bacteria | 6000 |
| 210 | Ga0466719_191445 | 3300042606 | Bacteria | 3020 |
| 211 | Ga0466720_053051 | 3300042607 | Bacteria | 11845 |
| 212 | Ga0466722_036609 | 3300042609 | Bacteria | 22552 |
| 213 | Ga0415639_011024 | 3300038395 | Unclassified | 5124 |
| 214 | Ga0466690_253353 | 3300042590 | Bacteria | 6696 |
| 215 | Ga0466692_061217 | 3300042591 | Bacteria | 34862 |
| 216 | Ga0466691_073031 | 3300042593 | Unclassified | 3129 |
| 217 | Ga0466691_105957 | 3300042593 | Bacteria | 3011 |
| 218 | Ga0466696_023816 | 3300042596 | Bacteria | 3825 |
| 219 | Ga0466696_298009 | 3300042596 | Bacteria | 8563 |
| 220 | Ga0466696_352716 | 3300042596 | Bacteria | 41032 |
| 221 | Ga0068305_10032411 | 3300005083 | Bacteria | 7707 |
| 222 | Ga0466705_530508 | 3300042612 | Unclassified | 5176 |
| 223 | Ga0466715_329218 | 3300042616 | Bacteria | 23323 |
| 224 | Ga0466715_643978 | 3300042616 | Bacteria | 3677 |
| 225 | Ga0466723_124226 | 3300042618 | Bacteria | 3059 |
| 226 | Ga0466723_333951 | 3300042618 | Bacteria | 11771 |
| 227 | Ga0466728_012178 | 3300042620 | Bacteria | 3404 |
| 228 | Ga0466728_195879 | 3300042620 | Bacteria | 4667 |
| 229 | Ga0466703_175340 | 3300042636 | Bacteria | 3373 |
| 230 | Ga0466709_416037 | 3300042648 | Bacteria | 1700 |
| 231 | Ga0466708_286264 | 3300042652 | Bacteria | 107074 |
| 232 | Ga0466708_303986 | 3300042652 | Bacteria | 11145 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00478 | GO:0003824 | catalytic activity | MF |
| PF01070 | GO:0016491 | oxidoreductase activity | MF |
| PF03060 | GO:0018580 | nitronate monooxygenase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.