Protein Family IF08089
Metagenome
Isolate
316
Members
85
Samples
291
Scaffolds
361
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_149562|Ga0466723_149562_1932_3170
- Length
- 412 aa
- Sequence
- MVVALGTNKKAAFPSSTGPWEMHKEMSSMAKESEGMKFAPKGKPNPVVKKGDFSFAATGLDHGHIYGICNGLIEAGAVLKSVYDPDPAKVEAFRNQYPETAAARSEEEILSDPDIKLVAGAAVTSERCALGLRVMSAGKDYFTDKAPLTTLEQLEAAKAKVKETGKKYMVYYSERIHVESAVFAGDLIAQGAIGRVIQVLGLGPHRLGHPSTRPAWFFRKEKYGGILCDIGSHQIEQFLFYAGAKDAVVTHSRIGNYNYPDYPELEDFGDACLVGDNGATQYFRVDWFTPDGLQSWGDGRAFILGTDGFIEQRKYMNLGLENSGGSYVYLANGRGEHYYDVSGKVGYPYFGQLILDCLNRTENAMTQEHAFKAAELCVKAQMQAIRVAGPPPAPEFRPAPXXXXGLVQDQGL
Sample Types
Isolate
7.9%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.1%
Unclassified
31.3%
Kalotermitidae
16.9%
Termopsidae
3.6%
Passalidae
3.6%
Rhinotermitidae
2.4%
Hydrophilidae
1.2%
Tenebrionidae
1.2%
Hodotermitidae
1.2%
Armadillidiidae
1.2%
Formicidae
1.2%
Taxonomy
Archaea
1
Bacteria
304
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 2 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 3 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 4 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 5 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 15 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 16 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 17 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 18 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 19 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 20 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 21 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 22 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 28 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 2873558832 | Propioniciclava coleopterorum HDW11 | Isolate | Hydrophilidae |
| 31 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 32 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 36 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 37 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 42 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 46 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 47 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 48 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 49 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 50 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 51 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 52 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 53 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 54 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 55 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 56 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 57 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 58 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 59 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 60 | 2820590132 | Unclassified Firmicutes Emb289P1bin84 | Isolate | Unclassified |
| 61 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 62 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 63 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 64 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 65 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 66 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 67 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 68 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 69 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 70 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 71 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 72 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 73 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 74 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 75 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 76 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 77 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 78 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 79 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 80 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 81 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 82 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_242663 | 3300042612 | Bacteria | 5556 |
| 2 | Ga0466733_019100 | 3300042659 | Bacteria | 6580 |
| 3 | Ga0466733_202245 | 3300042659 | Bacteria | 2155 |
| 4 | JGI24695J34938_10025644 | 3300002450 | Bacteria | 2814 |
| 5 | JGI24703J35330_11748025 | 3300002501 | Bacteria | 9995 |
| 6 | Ga0123356_10010365 | 3300010049 | Bacteria | 9148 |
| 7 | Ga0123356_10015060 | 3300010049 | Bacteria | 7418 |
| 8 | Ga0123356_10040606 | 3300010049 | Bacteria | 4335 |
| 9 | Ga0123356_10053624 | 3300010049 | Bacteria | 3753 |
| 10 | Ga0123353_10099602 | 3300010167 | Bacteria | 4684 |
| 11 | Ga0123353_10147950 | 3300010167 | Bacteria | 3754 |
| 12 | Ga0123353_10199988 | 3300010167 | Bacteria | 3145 |
| 13 | Ga0466707_203115 | 3300042601 | Bacteria | 1783 |
| 14 | Ga0466707_378512 | 3300042601 | Bacteria | 2058 |
| 15 | Ga0466716_280965 | 3300042605 | Bacteria | 1379 |
| 16 | Ga0466719_076148 | 3300042606 | Bacteria | 3595 |
| 17 | Ga0466719_370134 | 3300042606 | Bacteria | 8254 |
| 18 | Ga0466721_228297 | 3300042608 | Unclassified | 13700 |
| 19 | Ga0466722_065606 | 3300042609 | Bacteria | 9316 |
| 20 | Ga0466711_241856 | 3300042615 | Bacteria | 4371 |
| 21 | Ga0466715_048142 | 3300042616 | Bacteria | 2087 |
| 22 | Ga0466715_523399 | 3300042616 | Bacteria | 3299 |
| 23 | Ga0466726_072715 | 3300042619 | Bacteria | 1495 |
| 24 | Ga0466726_367891 | 3300042619 | Bacteria | 4235 |
| 25 | Ga0466731_119247 | 3300042622 | Bacteria | 2574 |
| 26 | Ga0466703_189272 | 3300042636 | Bacteria | 1351 |
| 27 | Ga0466709_078191 | 3300042648 | Bacteria | 4040 |
| 28 | Ga0466727_341318 | 3300042655 | Bacteria | 3400 |
| 29 | Ga0415639_005361 | 3300038395 | Bacteria | 5638 |
| 30 | Ga0415639_013845 | 3300038395 | Bacteria | 10185 |
| 31 | Ga0466690_062156 | 3300042590 | Bacteria | 4472 |
| 32 | Ga0466690_141378 | 3300042590 | Bacteria | 6018 |
| 33 | Ga0466692_197812 | 3300042591 | Bacteria | 1517 |
| 34 | Ga0466696_013758 | 3300042596 | Bacteria | 4346 |
| 35 | Ga0466699_087539 | 3300042597 | Bacteria | 31878 |
| 36 | Ga0466699_184175 | 3300042597 | Bacteria | 26088 |
| 37 | IMNBL1DRAFT_c0002703 | 3300000062 | Bacteria | 12092 |
| 38 | IMNBL1DRAFT_c0003622 | 3300000062 | Bacteria | 9779 |
| 39 | IMNBL1DRAFT_c0004015 | 3300000062 | Bacteria | 9059 |
| 40 | JGI24698J34947_10002983 | 3300002449 | Bacteria | 9169 |
| 41 | JGI24698J34947_10040542 | 3300002449 | Bacteria | 2403 |
| 42 | JGI24695J34938_10003314 | 3300002450 | Bacteria | 11346 |
| 43 | Ga0123355_10612521 | 3300009826 | Bacteria | 1287 |
| 44 | Ga0123353_10004616 | 3300010167 | Bacteria | 17780 |
| 45 | Ga0466707_413204 | 3300042601 | Bacteria | 1912 |
| 46 | Ga0466714_083272 | 3300042603 | Bacteria | 1458 |
| 47 | Ga0466716_052191 | 3300042605 | Bacteria | 7272 |
| 48 | Ga0466720_121236 | 3300042607 | Bacteria | 26505 |
| 49 | Ga0466721_081145 | 3300042608 | Bacteria | 15097 |
| 50 | Ga0466722_027259 | 3300042609 | Bacteria | 3516 |
| 51 | Ga0466712_108453 | 3300042614 | Bacteria | 4341 |
| 52 | Ga0466712_136278 | 3300042614 | Unclassified | 5429 |
| 53 | Ga0466715_605325 | 3300042616 | Bacteria | 20541 |
| 54 | Ga0466723_027533 | 3300042618 | Bacteria | 2678 |
| 55 | Ga0466723_079473 | 3300042618 | Bacteria | 10493 |
| 56 | Ga0466723_149562 | 3300042618 | Bacteria | 8486 |
| 57 | Ga0466726_463984 | 3300042619 | Bacteria | 3915 |
| 58 | Ga0466735_048761 | 3300042624 | Bacteria | 1892 |
| 59 | Ga0466735_057956 | 3300042624 | Bacteria | 27086 |
| 60 | Ga0466735_071948 | 3300042624 | Bacteria | 1296 |
| 61 | Ga0466703_086774 | 3300042636 | Bacteria | 2535 |
| 62 | Ga0466703_108030 | 3300042636 | Bacteria | 1318 |
| 63 | Ga0466704_153325 | 3300042643 | Bacteria | 5202 |
| 64 | Ga0466704_293057 | 3300042643 | Bacteria | 9065 |
| 65 | Ga0466704_491806 | 3300042643 | Unclassified | 1720 |
| 66 | Ga0466704_530060 | 3300042643 | Bacteria | 2216 |
| 67 | Ga0466709_317752 | 3300042648 | Bacteria | 5060 |
| 68 | Ga0466709_377188 | 3300042648 | Bacteria | 8339 |
| 69 | Ga0466708_008797 | 3300042652 | Bacteria | 15853 |
| 70 | Ga0466691_167028 | 3300042593 | Bacteria | 22010 |
| 71 | Ga0466691_178564 | 3300042593 | Bacteria | 13035 |
| 72 | Ga0466691_195549 | 3300042593 | Bacteria | 11829 |
| 73 | Ga0466696_199855 | 3300042596 | Bacteria | 11080 |
| 74 | Ga0466699_049690 | 3300042597 | Bacteria | 13748 |
| 75 | Ga0466705_016687 | 3300042612 | Unclassified | 4265 |
| 76 | Ga0466705_074926 | 3300042612 | Bacteria | 1558 |
| 77 | Ga0466705_108181 | 3300042612 | Bacteria | 6568 |
| 78 | 2227358566 | 2225789004 | Bacteria | 28335 |
| 79 | AustNasuHG_c1002131 | 3300000089 | Bacteria | 7150 |
| 80 | Ga0072940_1035070 | 3300005200 | Bacteria | 10675 |
| 81 | Ga0072940_1092882 | 3300005200 | Bacteria | 2607 |
| 82 | Ga0123357_10068439 | 3300009784 | Bacteria | 4723 |
| 83 | Ga0123357_10081566 | 3300009784 | Bacteria | 4251 |
| 84 | Ga0123355_10001992 | 3300009826 | Bacteria | 28838 |
| 85 | Ga0123355_10247525 | 3300009826 | Bacteria | 2515 |
| 86 | Ga0123356_10052859 | 3300010049 | Bacteria | 3779 |
| 87 | Ga0123356_10258036 | 3300010049 | Bacteria | 1825 |
| 88 | Ga0123356_10494698 | 3300010049 | Bacteria | 1378 |
| 89 | Ga0123353_10110767 | 3300010167 | Bacteria | 4423 |
| 90 | Ga0123353_10125262 | 3300010167 | Bacteria | 4129 |
| 91 | Ga0123353_10155842 | 3300010167 | Bacteria | 3641 |
| 92 | Ga0123354_10001263 | 3300010882 | Bacteria | 30053 |
| 93 | Ga0466706_087259 | 3300042599 | Bacteria | 1757 |
| 94 | Ga0466700_145192 | 3300042600 | Bacteria | 27380 |
| 95 | Ga0466719_219886 | 3300042606 | Unclassified | 3116 |
| 96 | Ga0466720_009757 | 3300042607 | Bacteria | 5519 |
| 97 | Ga0466720_027618 | 3300042607 | Bacteria | 12153 |
| 98 | Ga0466715_371410 | 3300042616 | Bacteria | 1403 |
| 99 | Ga0466726_396873 | 3300042619 | Bacteria | 2050 |
| 100 | Ga0466704_142723 | 3300042643 | Archaea | 2143 |
| 101 | Ga0466709_209133 | 3300042648 | Bacteria | 3802 |
| 102 | Ga0466708_079049 | 3300042652 | Bacteria | 28226 |
| 103 | Ga0466708_384451 | 3300042652 | Bacteria | 5011 |
| 104 | Ga0264413_113985 | 3300024493 | Bacteria | 28252 |
| 105 | Ga0466690_345473 | 3300042590 | Bacteria | 5269 |
| 106 | Ga0466692_179618 | 3300042591 | Bacteria | 6050 |
| 107 | Ga0466691_132354 | 3300042593 | Bacteria | 2291 |
| 108 | Ga0466691_195906 | 3300042593 | Bacteria | 10795 |
| 109 | Ga0466694_001477 | 3300042594 | Bacteria | 16253 |
| 110 | Ga0466694_059017 | 3300042594 | Bacteria | 1647 |
| 111 | Ga0466699_092978 | 3300042597 | Bacteria | 17484 |
| 112 | Ga0562374_0474 | 3300057007 | Bacteria | 67742 |
| 113 | 2226994841 | 2225789003 | Bacteria | 1462 |
| 114 | IMNBL1DRAFT_c0002012 | 3300000062 | Bacteria | 14564 |
| 115 | AustNasuHG_c1028987 | 3300000089 | Bacteria | 1636 |
| 116 | Ga0123355_10000203 | 3300009826 | Bacteria | 74062 |
| 117 | Ga0123356_10007898 | 3300010049 | Bacteria | 10591 |
| 118 | Ga0123356_10020287 | 3300010049 | Bacteria | 6291 |
| 119 | Ga0123356_10041561 | 3300010049 | Bacteria | 4284 |
| 120 | Ga0123356_10135268 | 3300010049 | Bacteria | 2422 |
| 121 | Ga0123353_10000086 | 3300010167 | Bacteria | 103533 |
| 122 | Ga0123353_10172444 | 3300010167 | Bacteria | 3432 |
| 123 | Ga0123353_10509736 | 3300010167 | Bacteria | 1750 |
| 124 | Ga0466706_082856 | 3300042599 | Bacteria | 1425 |
| 125 | Ga0466714_133148 | 3300042603 | Bacteria | 1884 |
| 126 | Ga0466719_039677 | 3300042606 | Bacteria | 5340 |
| 127 | Ga0466719_401196 | 3300042606 | Bacteria | 21331 |
| 128 | Ga0466720_187111 | 3300042607 | Bacteria | 2531 |
| 129 | Ga0466721_056665 | 3300042608 | Bacteria | 2070 |
| 130 | Ga0466721_064563 | 3300042608 | Bacteria | 36610 |
| 131 | Ga0466722_251493 | 3300042609 | Bacteria | 54791 |
| 132 | Ga0466698_011576 | 3300042610 | Bacteria | 51802 |
| 133 | Ga0466698_440659 | 3300042610 | Bacteria | 1681 |
| 134 | Ga0466711_221867 | 3300042615 | Bacteria | 2725 |
| 135 | Ga0466715_009285 | 3300042616 | Bacteria | 2442 |
| 136 | Ga0466715_111612 | 3300042616 | Bacteria | 33180 |
| 137 | Ga0466715_471206 | 3300042616 | Bacteria | 8445 |
| 138 | Ga0466718_086576 | 3300042617 | Bacteria | 6008 |
| 139 | Ga0466723_279863 | 3300042618 | Bacteria | 3676 |
| 140 | Ga0466726_028573 | 3300042619 | Bacteria | 11860 |
| 141 | Ga0466726_098152 | 3300042619 | Bacteria | 2193 |
| 142 | Ga0466726_153542 | 3300042619 | Bacteria | 2511 |
| 143 | Ga0466726_332825 | 3300042619 | Bacteria | 1631 |
| 144 | Ga0466703_131025 | 3300042636 | Bacteria | 3002 |
| 145 | Ga0466704_011040 | 3300042643 | Bacteria | 10231 |
| 146 | Ga0160455_100863 | 3300012837 | Bacteria | 11615 |
| 147 | Ga0264413_105325 | 3300024493 | Bacteria | 7319 |
| 148 | Ga0415639_111778 | 3300038395 | Bacteria | 2590 |
| 149 | Ga0466690_272478 | 3300042590 | Bacteria | 2285 |
| 150 | Ga0466696_077662 | 3300042596 | Bacteria | 13173 |
| 151 | Ga0466696_325708 | 3300042596 | Bacteria | 1569 |
| 152 | 2227480197 | 2225789004 | Bacteria | 22192 |
| 153 | IMNBL1DRAFT_c0001614 | 3300000062 | Bacteria | 16718 |
| 154 | JGI24695J34938_10000137 | 3300002450 | Bacteria | 66242 |
| 155 | JGI24700J35501_10930300 | 3300002508 | Bacteria | 12856 |
| 156 | Ga0068305_10062379 | 3300005083 | Bacteria | 17106 |
| 157 | Ga0072941_1009808 | 3300005201 | Bacteria | 14933 |
| 158 | Ga0123357_10045894 | 3300009784 | Bacteria | 5926 |
| 159 | Ga0123354_10037958 | 3300010882 | Bacteria | 7487 |
| 160 | Ga0466706_099195 | 3300042599 | Bacteria | 12783 |
| 161 | Ga0466706_255984 | 3300042599 | Bacteria | 8537 |
| 162 | Ga0466707_174112 | 3300042601 | Bacteria | 7880 |
| 163 | Ga0466714_049605 | 3300042603 | Bacteria | 2109 |
| 164 | Ga0466714_090607 | 3300042603 | Bacteria | 5310 |
| 165 | Ga0466722_118691 | 3300042609 | Bacteria | 4045 |
| 166 | Ga0466722_124675 | 3300042609 | Bacteria | 31138 |
| 167 | Ga0466705_435987 | 3300042612 | Bacteria | 1566 |
| 168 | Ga0466712_247116 | 3300042614 | Bacteria | 11346 |
| 169 | Ga0466715_202416 | 3300042616 | Bacteria | 4028 |
| 170 | Ga0466723_108925 | 3300042618 | Unclassified | 1952 |
| 171 | Ga0466723_255837 | 3300042618 | Bacteria | 2447 |
| 172 | Ga0466703_068295 | 3300042636 | Bacteria | 3432 |
| 173 | Ga0466703_152163 | 3300042636 | Bacteria | 7413 |
| 174 | Ga0466704_096442 | 3300042643 | Bacteria | 5487 |
| 175 | Ga0466704_294181 | 3300042643 | Bacteria | 4386 |
| 176 | Ga0466708_120110 | 3300042652 | Bacteria | 21676 |
| 177 | Ga0466708_358086 | 3300042652 | Bacteria | 2251 |
| 178 | Ga0415639_002391 | 3300038395 | Bacteria | 3229 |
| 179 | Ga0415639_008087 | 3300038395 | Bacteria | 5800 |
| 180 | Ga0466690_133067 | 3300042590 | Bacteria | 5289 |
| 181 | Ga0466692_007352 | 3300042591 | Bacteria | 4996 |
| 182 | Ga0466696_429311 | 3300042596 | Bacteria | 9166 |
| 183 | Ga0466699_229220 | 3300042597 | Bacteria | 12855 |
| 184 | Ga0466705_001078 | 3300042612 | Unclassified | 3370 |
| 185 | JGI24698J34947_10003127 | 3300002449 | Bacteria | 8968 |
| 186 | JGI24696J40584_12960517 | 3300002834 | Bacteria | 7468 |
| 187 | Ga0068305_10230747 | 3300005083 | Bacteria | 11004 |
| 188 | Ga0072941_1070284 | 3300005201 | Bacteria | 5774 |
| 189 | Ga0074263_110800 | 3300005485 | Unclassified | 2067 |
| 190 | Ga0102734_1000488 | 3300007129 | Bacteria | 19630 |
| 191 | Ga0123356_10002116 | 3300010049 | Bacteria | 21417 |
| 192 | Ga0123356_10002891 | 3300010049 | Bacteria | 18192 |
| 193 | Ga0123356_10021037 | 3300010049 | Bacteria | 6170 |
| 194 | Ga0123356_10524595 | 3300010049 | Bacteria | 1343 |
| 195 | Ga0123353_10237938 | 3300010167 | Bacteria | 2832 |
| 196 | Ga0466714_082579 | 3300042603 | Unclassified | 1265 |
| 197 | Ga0466717_170915 | 3300042604 | Bacteria | 2923 |
| 198 | Ga0466716_017184 | 3300042605 | Bacteria | 4745 |
| 199 | Ga0466719_144963 | 3300042606 | Bacteria | 1895 |
| 200 | Ga0466705_474471 | 3300042612 | Bacteria | 2857 |
| 201 | Ga0466711_250812 | 3300042615 | Bacteria | 11619 |
| 202 | Ga0466726_045425 | 3300042619 | Bacteria | 2603 |
| 203 | Ga0466726_121235 | 3300042619 | Bacteria | 31297 |
| 204 | Ga0466735_139514 | 3300042624 | Bacteria | 4003 |
| 205 | Ga0466703_274139 | 3300042636 | Bacteria | 9998 |
| 206 | Ga0466704_202606 | 3300042643 | Bacteria | 5663 |
| 207 | Ga0466704_538599 | 3300042643 | Bacteria | 2011 |
| 208 | Ga0466727_184810 | 3300042655 | Bacteria | 1308 |
| 209 | Ga0415639_108524 | 3300038395 | Bacteria | 6329 |
| 210 | Ga0466693_309130 | 3300042592 | Bacteria | 1804 |
| 211 | Ga0466696_015061 | 3300042596 | Bacteria | 4125 |
| 212 | Ga0466696_188948 | 3300042596 | Bacteria | 5653 |
| 213 | Ga0466699_133970 | 3300042597 | Bacteria | 2152 |
| 214 | Ga0466699_144124 | 3300042597 | Bacteria | 1738 |
| 215 | Ga0466699_160610 | 3300042597 | Bacteria | 1715 |
| 216 | Ga0466705_099379 | 3300042612 | Bacteria | 9181 |
| 217 | Ga0466705_230926 | 3300042612 | Bacteria | 5343 |
| 218 | Ga0466733_202109 | 3300042659 | Bacteria | 1372 |
| 219 | 2227080779 | 2225789004 | Bacteria | 173520 |
| 220 | IMNBL1DRAFT_c0005274 | 3300000062 | Bacteria | 7447 |
| 221 | IMNBL1DRAFT_c0036736 | 3300000062 | Unclassified | 1706 |
| 222 | JGI24703J35330_11712932 | 3300002501 | Bacteria | 2214 |
| 223 | Ga0123355_10013508 | 3300009826 | Bacteria | 12718 |
| 224 | Ga0123355_10025707 | 3300009826 | Bacteria | 9481 |
| 225 | Ga0123355_10042563 | 3300009826 | Bacteria | 7393 |
| 226 | Ga0123356_10137964 | 3300010049 | Bacteria | 2401 |
| 227 | Ga0123353_10000319 | 3300010167 | Bacteria | 59439 |
| 228 | Ga0123353_10035855 | 3300010167 | Bacteria | 7763 |
| 229 | Ga0123353_10056193 | 3300010167 | Bacteria | 6299 |
| 230 | Ga0123353_10698307 | 3300010167 | Bacteria | 1425 |
| 231 | Ga0466706_232880 | 3300042599 | Bacteria | 2776 |
| 232 | Ga0466707_226062 | 3300042601 | Bacteria | 1440 |
| 233 | Ga0466713_050441 | 3300042602 | Bacteria | 2734 |
| 234 | Ga0466714_009368 | 3300042603 | Bacteria | 3970 |
| 235 | Ga0466714_015674 | 3300042603 | Bacteria | 4927 |
| 236 | Ga0466714_119471 | 3300042603 | Bacteria | 28498 |
| 237 | Ga0466716_023450 | 3300042605 | Bacteria | 4027 |
| 238 | Ga0466716_540864 | 3300042605 | Bacteria | 4581 |
| 239 | Ga0466722_017701 | 3300042609 | Bacteria | 3433 |
| 240 | Ga0466712_016189 | 3300042614 | Bacteria | 8513 |
| 241 | Ga0466711_399656 | 3300042615 | Bacteria | 2647 |
| 242 | Ga0466715_094746 | 3300042616 | Bacteria | 6255 |
| 243 | Ga0466715_336312 | 3300042616 | Bacteria | 13465 |
| 244 | Ga0466715_511549 | 3300042616 | Bacteria | 4312 |
| 245 | Ga0466728_109565 | 3300042620 | Bacteria | 6318 |
| 246 | Ga0466728_135704 | 3300042620 | Bacteria | 6449 |
| 247 | Ga0466703_154696 | 3300042636 | Bacteria | 54905 |
| 248 | Ga0466703_213023 | 3300042636 | Bacteria | 7429 |
| 249 | Ga0466709_102376 | 3300042648 | Bacteria | 11270 |
| 250 | Ga0466708_049317 | 3300042652 | Bacteria | 23244 |
| 251 | Ga0466727_118979 | 3300042655 | Bacteria | 7531 |
| 252 | Ga0415639_008088 | 3300038395 | Bacteria | 7822 |
| 253 | Ga0415639_026356 | 3300038395 | Bacteria | 9602 |
| 254 | Ga0466690_237320 | 3300042590 | Bacteria | 2693 |
| 255 | Ga0466694_312496 | 3300042594 | Bacteria | 3217 |
| 256 | Ga0466696_261310 | 3300042596 | Bacteria | 12858 |
| 257 | Ga0466696_401830 | 3300042596 | Bacteria | 4091 |
| 258 | Ga0466705_283729 | 3300042612 | Bacteria | 3264 |
| 259 | Ga0466732_319315 | 3300042656 | Bacteria | 3031 |
| 260 | IMNBL1DRAFT_c0000078 | 3300000062 | Bacteria | 87415 |
| 261 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 262 | Ga0123356_10000444 | 3300010049 | Bacteria | 46876 |
| 263 | Ga0123356_10000636 | 3300010049 | Bacteria | 38737 |
| 264 | Ga0123356_10007214 | 3300010049 | Bacteria | 11116 |
| 265 | Ga0123356_10009665 | 3300010049 | Bacteria | 9514 |
| 266 | Ga0123356_10182059 | 3300010049 | Bacteria | 2124 |
| 267 | Ga0466706_082161 | 3300042599 | Bacteria | 16044 |
| 268 | Ga0466700_037867 | 3300042600 | Bacteria | 1644 |
| 269 | Ga0466707_090249 | 3300042601 | Bacteria | 2775 |
| 270 | Ga0466707_247327 | 3300042601 | Bacteria | 3263 |
| 271 | Ga0466722_218803 | 3300042609 | Bacteria | 2389 |
| 272 | Ga0466712_202610 | 3300042614 | Bacteria | 1619 |
| 273 | Ga0466711_097395 | 3300042615 | Bacteria | 9855 |
| 274 | Ga0466715_039296 | 3300042616 | Bacteria | 4818 |
| 275 | Ga0466715_444063 | 3300042616 | Bacteria | 9610 |
| 276 | Ga0466715_499790 | 3300042616 | Bacteria | 22846 |
| 277 | Ga0466726_177055 | 3300042619 | Bacteria | 2427 |
| 278 | Ga0466728_098053 | 3300042620 | Bacteria | 5220 |
| 279 | Ga0466728_105039 | 3300042620 | Bacteria | 7224 |
| 280 | Ga0466735_021963 | 3300042624 | Bacteria | 2593 |
| 281 | Ga0466704_009188 | 3300042643 | Bacteria | 8102 |
| 282 | Ga0466704_021995 | 3300042643 | Bacteria | 19535 |
| 283 | Ga0466704_268072 | 3300042643 | Bacteria | 16253 |
| 284 | Ga0466704_319189 | 3300042643 | Unclassified | 7117 |
| 285 | Ga0466725_243316 | 3300042654 | Bacteria | 3313 |
| 286 | Ga0466727_020128 | 3300042655 | Bacteria | 21213 |
| 287 | Ga0415639_008326 | 3300038395 | Bacteria | 5072 |
| 288 | Ga0415639_025769 | 3300038395 | Bacteria | 14937 |
| 289 | Ga0466693_309346 | 3300042592 | Bacteria | 1533 |
| 290 | Ga0466691_162851 | 3300042593 | Bacteria | 20155 |
| 291 | Ga0466696_336662 | 3300042596 | Bacteria | 4851 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.