Protein Family IF08030
Metagenome
Isolate
229
Members
73
Samples
206
Scaffolds
196.45
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_059043|Ga0466723_059043_2669_3364
- Length
- 231 aa
- Sequence
- LHNYFFIPYFAPSNRKKLFAYKENITLTHQKLTVMKDLKLMSDEELVVAYAQGNNSAFDVLLSRHQSNVFSYIYFIVKNREQAEDIFQETFVKAIVTIKQGKYTETGRFRAWINRIAHNLIIDNYRQEKNGQTVSNDEYDVDLFNNHKLSEGTIEDEMVKSQILVDVKKLINCLPENQKEVLLLRYYQNLSFKEIADITGVSINTALGRMRYAILNMRRIAEKKKMILTMV
Sample Types
Isolate
10.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
30.1%
Kalotermitidae
19.2%
Blattidae
16.4%
Unclassified
13.7%
Rhinotermitidae
6.8%
Termopsidae
5.5%
Hydrophilidae
2.7%
Passalidae
2.7%
Hodotermitidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
1
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 13 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 14 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 20 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 21 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 22 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 31 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 38 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 41 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 42 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 45 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 46 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 49 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 50 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 53 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 54 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 55 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 56 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 57 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 58 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 59 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 62 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 63 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 67 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 68 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 69 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227250835 | 2225789004 | Unclassified | 1320 |
| 2 | JGI24702J35022_10002729 | 3300002462 | Bacteria | 10706 |
| 3 | JGI24696J40584_12956464 | 3300002834 | Bacteria | 3122 |
| 4 | Ga0068305_10193747 | 3300005083 | Bacteria | 6190 |
| 5 | Ga0123357_10022134 | 3300009784 | Bacteria | 8518 |
| 6 | Ga0123357_10345836 | 3300009784 | Bacteria | 1430 |
| 7 | Ga0466711_264721 | 3300042615 | Bacteria | 26624 |
| 8 | Ga0466715_416650 | 3300042616 | Bacteria | 71840 |
| 9 | Ga0466728_057961 | 3300042620 | Bacteria | 56835 |
| 10 | Ga0466700_063913 | 3300042600 | Bacteria | 21421 |
| 11 | Ga0466700_450890 | 3300042600 | Bacteria | 11921 |
| 12 | Ga0466707_260043 | 3300042601 | Bacteria | 20986 |
| 13 | Ga0466707_378076 | 3300042601 | Bacteria | 5242 |
| 14 | Ga0466713_005558 | 3300042602 | Bacteria | 10134 |
| 15 | Ga0466713_123707 | 3300042602 | Bacteria | 19996 |
| 16 | Ga0466713_141674 | 3300042602 | Bacteria | 6891 |
| 17 | Ga0466714_058811 | 3300042603 | Bacteria | 71979 |
| 18 | Ga0466719_001774 | 3300042606 | Bacteria | 3280 |
| 19 | Ga0466730_062067 | 3300042625 | Archaea | 3908 |
| 20 | Ga0466703_020230 | 3300042636 | Bacteria | 2623 |
| 21 | Ga0466703_137673 | 3300042636 | Bacteria | 7150 |
| 22 | Ga0466704_267720 | 3300042643 | Bacteria | 30847 |
| 23 | Ga0466708_123801 | 3300042652 | Bacteria | 4409 |
| 24 | Ga0466690_272494 | 3300042590 | Bacteria | 17538 |
| 25 | Ga0466696_089692 | 3300042596 | Bacteria | 2131 |
| 26 | 2227247442 | 2225789004 | Bacteria | 32559 |
| 27 | IMNBL1DRAFT_c0000312 | 3300000062 | Bacteria | 41387 |
| 28 | IMNBL1DRAFT_c0000586 | 3300000062 | Bacteria | 29366 |
| 29 | JGI24696J40584_12959270 | 3300002834 | Bacteria | 4924 |
| 30 | Ga0123357_10003467 | 3300009784 | Bacteria | 18109 |
| 31 | Ga0123357_10009396 | 3300009784 | Bacteria | 12348 |
| 32 | Ga0123354_10008719 | 3300010882 | Bacteria | 15454 |
| 33 | Ga0123354_10520577 | 3300010882 | Unclassified | 914 |
| 34 | Ga0466705_448318 | 3300042612 | Bacteria | 8503 |
| 35 | Ga0466726_407205 | 3300042619 | Bacteria | 2220 |
| 36 | Ga0466728_046563 | 3300042620 | Unclassified | 1572 |
| 37 | Ga0466701_083828 | 3300042598 | Bacteria | 7767 |
| 38 | Ga0466706_111608 | 3300042599 | Bacteria | 1770 |
| 39 | Ga0466707_161572 | 3300042601 | Bacteria | 5739 |
| 40 | Ga0466707_257651 | 3300042601 | Bacteria | 4220 |
| 41 | Ga0466707_331501 | 3300042601 | Bacteria | 4814 |
| 42 | Ga0466713_008150 | 3300042602 | Bacteria | 5436 |
| 43 | Ga0466722_204774 | 3300042609 | Bacteria | 2015 |
| 44 | Ga0466698_356627 | 3300042610 | Bacteria | 3011 |
| 45 | Ga0466735_090852 | 3300042624 | Bacteria | 7986 |
| 46 | Ga0466735_185957 | 3300042624 | Bacteria | 3626 |
| 47 | Ga0466709_072115 | 3300042648 | Bacteria | 26950 |
| 48 | Ga0466690_087140 | 3300042590 | Bacteria | 6388 |
| 49 | Ga0466696_447285 | 3300042596 | Bacteria | 2337 |
| 50 | IMNBL1DRAFT_c0001732 | 3300000062 | Bacteria | 16014 |
| 51 | Ga0068305_10102235 | 3300005083 | Bacteria | 10518 |
| 52 | Ga0123357_10000359 | 3300009784 | Bacteria | 42994 |
| 53 | Ga0123357_10004633 | 3300009784 | Bacteria | 16222 |
| 54 | Ga0123357_10043906 | 3300009784 | Bacteria | 6070 |
| 55 | Ga0123356_10775074 | 3300010049 | Bacteria | 1130 |
| 56 | Ga0466710_205251 | 3300042613 | Bacteria | 1277 |
| 57 | Ga0466715_420652 | 3300042616 | Bacteria | 12675 |
| 58 | Ga0466726_126830 | 3300042619 | Bacteria | 3817 |
| 59 | Ga0466726_225443 | 3300042619 | Bacteria | 1166 |
| 60 | Ga0466701_020840 | 3300042598 | Bacteria | 1495 |
| 61 | Ga0466701_078947 | 3300042598 | Bacteria | 1023 |
| 62 | Ga0466700_427425 | 3300042600 | Bacteria | 9107 |
| 63 | Ga0466707_230323 | 3300042601 | Bacteria | 1113 |
| 64 | Ga0466707_396793 | 3300042601 | Bacteria | 1066 |
| 65 | Ga0466713_020418 | 3300042602 | Bacteria | 5002 |
| 66 | Ga0466713_059657 | 3300042602 | Bacteria | 33008 |
| 67 | Ga0466713_130834 | 3300042602 | Bacteria | 31381 |
| 68 | Ga0466717_211963 | 3300042604 | Bacteria | 1334 |
| 69 | Ga0466716_065427 | 3300042605 | Bacteria | 3618 |
| 70 | Ga0466722_209366 | 3300042609 | Bacteria | 18982 |
| 71 | Ga0466703_032030 | 3300042636 | Unclassified | 4064 |
| 72 | Ga0466703_097685 | 3300042636 | Unclassified | 1419 |
| 73 | Ga0466704_473619 | 3300042643 | Bacteria | 1607 |
| 74 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 75 | Ga0466693_071888 | 3300042592 | Unclassified | 1175 |
| 76 | Ga0466693_451440 | 3300042592 | Bacteria | 1553 |
| 77 | Ga0466691_038094 | 3300042593 | Bacteria | 2026 |
| 78 | Ga0466695_347947 | 3300042595 | Unclassified | 1417 |
| 79 | Ga0466705_202542 | 3300042612 | Bacteria | 10741 |
| 80 | IMNBL1DRAFT_c0148185 | 3300000062 | Bacteria | 603 |
| 81 | JGI24695J34938_10081971 | 3300002450 | Bacteria | 1332 |
| 82 | JGI24702J35022_10177120 | 3300002462 | Bacteria | 1209 |
| 83 | JGI24699J35502_11133898 | 3300002509 | Bacteria | 18539 |
| 84 | Ga0123357_10025230 | 3300009784 | Bacteria | 8014 |
| 85 | Ga0123357_10043808 | 3300009784 | Bacteria | 6077 |
| 86 | Ga0123354_10111876 | 3300010882 | Bacteria | 3599 |
| 87 | Ga0466710_304898 | 3300042613 | Bacteria | 1714 |
| 88 | Ga0466715_147874 | 3300042616 | Bacteria | 8029 |
| 89 | Ga0466707_226348 | 3300042601 | Bacteria | 14698 |
| 90 | Ga0466707_243405 | 3300042601 | Bacteria | 10754 |
| 91 | Ga0466707_284550 | 3300042601 | Bacteria | 19742 |
| 92 | Ga0466713_059535 | 3300042602 | Bacteria | 37029 |
| 93 | Ga0466713_088875 | 3300042602 | Bacteria | 3681 |
| 94 | Ga0466713_145264 | 3300042602 | Bacteria | 3152 |
| 95 | Ga0466719_270472 | 3300042606 | Bacteria | 3433 |
| 96 | Ga0466729_317409 | 3300042621 | Unclassified | 5548 |
| 97 | Ga0466735_021399 | 3300042624 | Bacteria | 17324 |
| 98 | Ga0466735_191953 | 3300042624 | Unclassified | 1374 |
| 99 | Ga0466703_033574 | 3300042636 | Bacteria | 1408 |
| 100 | Ga0466703_236109 | 3300042636 | Bacteria | 3049 |
| 101 | Ga0466704_374770 | 3300042643 | Unclassified | 2351 |
| 102 | Ga0466727_071993 | 3300042655 | Bacteria | 9088 |
| 103 | Ga0466727_310899 | 3300042655 | Unclassified | 3668 |
| 104 | Ga0466690_054099 | 3300042590 | Bacteria | 2774 |
| 105 | Ga0466692_005457 | 3300042591 | Bacteria | 6303 |
| 106 | Ga0466692_017863 | 3300042591 | Bacteria | 23869 |
| 107 | Ga0466697_102718 | 3300042611 | Bacteria | 1059 |
| 108 | Ga0466697_270300 | 3300042611 | Bacteria | 2178 |
| 109 | IMNBL1DRAFT_c0000467 | 3300000062 | Bacteria | 33813 |
| 110 | JGI24699J35502_11134178 | 3300002509 | Bacteria | 45574 |
| 111 | Ga0123357_10054778 | 3300009784 | Bacteria | 5374 |
| 112 | Ga0123356_12197431 | 3300010049 | Bacteria | 690 |
| 113 | Ga0123354_10000146 | 3300010882 | Bacteria | 55170 |
| 114 | Ga0123354_10060821 | 3300010882 | Bacteria | 5581 |
| 115 | Ga0466711_365911 | 3300042615 | Bacteria | 1665 |
| 116 | Ga0466715_150753 | 3300042616 | Bacteria | 6126 |
| 117 | Ga0466723_059043 | 3300042618 | Bacteria | 8005 |
| 118 | Ga0466726_015324 | 3300042619 | Bacteria | 2797 |
| 119 | Ga0466726_100799 | 3300042619 | Bacteria | 9381 |
| 120 | Ga0466729_019404 | 3300042621 | Bacteria | 2728 |
| 121 | Ga0466713_010027 | 3300042602 | Bacteria | 77850 |
| 122 | Ga0466713_082334 | 3300042602 | Bacteria | 4434 |
| 123 | Ga0466713_131581 | 3300042602 | Bacteria | 7311 |
| 124 | Ga0466716_092980 | 3300042605 | Bacteria | 25359 |
| 125 | Ga0466719_225067 | 3300042606 | Bacteria | 1252 |
| 126 | Ga0466735_155482 | 3300042624 | Bacteria | 3287 |
| 127 | Ga0466703_059223 | 3300042636 | Bacteria | 3920 |
| 128 | Ga0466703_099365 | 3300042636 | Unclassified | 2276 |
| 129 | Ga0466703_403696 | 3300042636 | Bacteria | 12492 |
| 130 | Ga0466704_061950 | 3300042643 | Bacteria | 5620 |
| 131 | Ga0466704_419667 | 3300042643 | Bacteria | 19776 |
| 132 | Ga0466656_083890 | 3300042550 | Bacteria | 3636 |
| 133 | Ga0466691_018496 | 3300042593 | Bacteria | 17321 |
| 134 | Ga0466694_358004 | 3300042594 | Bacteria | 5415 |
| 135 | Ga0466705_264453 | 3300042612 | Bacteria | 6349 |
| 136 | Ga0466733_144100 | 3300042659 | Bacteria | 7844 |
| 137 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 138 | IMNBL1DRAFT_c0110413 | 3300000062 | Unclassified | 731 |
| 139 | JGI24702J35022_10002429 | 3300002462 | Bacteria | 11372 |
| 140 | JGI24705J35276_12213936 | 3300002504 | Bacteria | 1942 |
| 141 | Ga0123357_10336640 | 3300009784 | Unclassified | 1466 |
| 142 | Ga0123357_10497819 | 3300009784 | Unclassified | 1015 |
| 143 | Ga0123355_10415259 | 3300009826 | Bacteria | 1724 |
| 144 | Ga0123354_10030047 | 3300010882 | Bacteria | 8539 |
| 145 | Ga0123354_10147880 | 3300010882 | Bacteria | 2865 |
| 146 | Ga0466705_454122 | 3300042612 | Unclassified | 3846 |
| 147 | Ga0466711_126406 | 3300042615 | Bacteria | 3441 |
| 148 | Ga0466711_173885 | 3300042615 | Bacteria | 5019 |
| 149 | Ga0466711_285081 | 3300042615 | Bacteria | 2178 |
| 150 | Ga0466715_131055 | 3300042616 | Bacteria | 12854 |
| 151 | Ga0466715_480866 | 3300042616 | Bacteria | 8346 |
| 152 | Ga0466723_312779 | 3300042618 | Bacteria | 1547 |
| 153 | Ga0466713_082373 | 3300042602 | Bacteria | 18425 |
| 154 | Ga0466713_151406 | 3300042602 | Bacteria | 82944 |
| 155 | Ga0466716_070279 | 3300042605 | Bacteria | 9715 |
| 156 | Ga0466716_237081 | 3300042605 | Bacteria | 27405 |
| 157 | Ga0466716_384199 | 3300042605 | Bacteria | 2810 |
| 158 | Ga0466735_104657 | 3300042624 | Unclassified | 1739 |
| 159 | Ga0466735_215355 | 3300042624 | Bacteria | 2617 |
| 160 | Ga0466703_243974 | 3300042636 | Bacteria | 11125 |
| 161 | Ga0466704_480099 | 3300042643 | Bacteria | 39129 |
| 162 | Ga0466727_253174 | 3300042655 | Bacteria | 42635 |
| 163 | Ga0466692_117229 | 3300042591 | Bacteria | 56912 |
| 164 | Ga0466696_498445 | 3300042596 | Bacteria | 1485 |
| 165 | Ga0466733_024002 | 3300042659 | Bacteria | 39250 |
| 166 | JGI24699J35502_11134212 | 3300002509 | Bacteria | 62331 |
| 167 | JGI24696J40584_12956214 | 3300002834 | Bacteria | 3044 |
| 168 | Ga0068305_10014183 | 3300005083 | Bacteria | 16096 |
| 169 | Ga0123357_10321123 | 3300009784 | Bacteria | 1529 |
| 170 | Ga0123357_10641908 | 3300009784 | Unclassified | 791 |
| 171 | Ga0123354_10000888 | 3300010882 | Bacteria | 33343 |
| 172 | Ga0466726_171026 | 3300042619 | Bacteria | 1136 |
| 173 | Ga0466707_226849 | 3300042601 | Bacteria | 6964 |
| 174 | Ga0466714_117493 | 3300042603 | Bacteria | 34193 |
| 175 | Ga0466719_554744 | 3300042606 | Bacteria | 3723 |
| 176 | Ga0466735_007206 | 3300042624 | Bacteria | 5114 |
| 177 | Ga0466703_424276 | 3300042636 | Bacteria | 1580 |
| 178 | Ga0466709_368131 | 3300042648 | Bacteria | 3001 |
| 179 | Ga0466708_119023 | 3300042652 | Bacteria | 10074 |
| 180 | Ga0466727_308966 | 3300042655 | Bacteria | 6238 |
| 181 | Ga0466690_164624 | 3300042590 | Bacteria | 7555 |
| 182 | Ga0466692_150288 | 3300042591 | Bacteria | 38717 |
| 183 | Ga0466691_000556 | 3300042593 | Bacteria | 3440 |
| 184 | Ga0466733_121483 | 3300042659 | Bacteria | 4576 |
| 185 | IMNBL1DRAFT_c0012639 | 3300000062 | Bacteria | 3846 |
| 186 | Ga0068302_10224522 | 3300005071 | Bacteria | 4575 |
| 187 | Ga0068305_10281506 | 3300005083 | Unclassified | 4700 |
| 188 | Ga0123357_10091803 | 3300009784 | Bacteria | 3953 |
| 189 | Ga0123354_10214606 | 3300010882 | Unclassified | 2066 |
| 190 | Ga0123354_10341563 | 3300010882 | Bacteria | 1349 |
| 191 | Ga0466711_174407 | 3300042615 | Bacteria | 2819 |
| 192 | Ga0466715_123008 | 3300042616 | Bacteria | 31782 |
| 193 | Ga0466726_145668 | 3300042619 | Bacteria | 14266 |
| 194 | Ga0466728_087812 | 3300042620 | Bacteria | 65534 |
| 195 | Ga0466728_399272 | 3300042620 | Bacteria | 209367 |
| 196 | Ga0466706_288578 | 3300042599 | Bacteria | 3779 |
| 197 | Ga0466700_156007 | 3300042600 | Bacteria | 3527 |
| 198 | Ga0466698_473215 | 3300042610 | Bacteria | 1755 |
| 199 | Ga0466735_030720 | 3300042624 | Bacteria | 1450 |
| 200 | Ga0466735_043297 | 3300042624 | Bacteria | 1055 |
| 201 | Ga0466703_127806 | 3300042636 | Bacteria | 4299 |
| 202 | Ga0466704_013664 | 3300042643 | Bacteria | 7799 |
| 203 | Ga0466709_342148 | 3300042648 | Bacteria | 6030 |
| 204 | Ga0466690_185946 | 3300042590 | Bacteria | 26397 |
| 205 | Ga0466691_001192 | 3300042593 | Bacteria | 6426 |
| 206 | Ga0466696_461433 | 3300042596 | Bacteria | 6270 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.