Protein Family IF07850
Metagenome
Isolate
343
Members
197
Samples
201
Scaffolds
307.2
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_631008|Ga0466715_631008_85_1212
- Length
- 375 aa
- Sequence
- MLRLVCGLRLAKKNRAAAAKLLDKRLGMSDNRCIKWRGKSLGLLQALMPLQECARDKRQKRKRELMVELKSVCKSFGSVQALKNISISAGSGRAYGLLGRNGAGKTTTLRIIMDIFKPDRGTVLIDGKPAGKSNARIGYLPEERGLYPRRLVGEQMVYIGVLRGLSKETAQRNAKRLLKELEVPEYYQRKLETLSKGNQQKIQLAVALISEPDLLILDEPFSGLDPVNAKILKDIVKKQSAEGKTILFSSHQMSQVEEFCEEICIINKGEKVLEGRIDDIKRSYPRNIYYVSVGGFAADEFLTAVMRQMGSWCKGIRRKGPGFEVALVEPSARGMLFDAIRQQGLTPEVFTVKEPTLEEIFVEKAGGSDETGEEN
Sample Types
Isolate
41.4%
Metagenome
58.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
25.6%
Termitidae
16.1%
Drosophilidae
12.2%
Apidae
9.4%
Kalotermitidae
5.6%
Halictidae
5.0%
Pyralidae
3.3%
Tenebrionidae
3.3%
Rhinotermitidae
2.8%
Scarabaeidae
2.8%
Bombycidae
1.7%
Termopsidae
1.7%
Formicidae
1.7%
Passalidae
1.1%
Elmidae
1.1%
Blattidae
1.1%
Portunidae
0.6%
Dytiscidae
0.6%
Vespidae
0.6%
Libellulidae
0.6%
Hydrophilidae
0.6%
Noctuidae
0.6%
Eresidae
0.6%
Culicidae
0.6%
Gomphidae
0.6%
Ocypodidae
0.6%
Taxonomy
Archaea
0
Bacteria
323
Eukaryota
0
Viruses
0
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 2 | 2820950349 | Unclassified Acidobacteria Lab288P3bin89 | Isolate | Unclassified |
| 3 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 4 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 5 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 6 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 7 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 8 | 2619619079 | Sphingomonas sp. Mn802worker | Isolate | Termitidae |
| 9 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 10 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 11 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 12 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 13 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 14 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 15 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 16 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 17 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 18 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 19 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 20 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 21 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 22 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 23 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 24 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 25 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 26 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 30 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 31 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 32 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 33 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 34 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 35 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 36 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 37 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 40 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 41 | 2864955722 | Sphingomonas kyeonggiensis S00224 | Isolate | Elmidae |
| 42 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 43 | 2873597894 | Erysipelothrix sp. HDW6B | Isolate | Unclassified |
| 44 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 45 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 46 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 47 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 48 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 49 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 50 | 2820733257 | Unclassified Chloroflexi Lab288P4bin59 | Isolate | Unclassified |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 53 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 54 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 58 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 59 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 60 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 61 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 62 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 63 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 64 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 65 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 66 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 67 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 68 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 69 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 70 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 71 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 72 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 73 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 74 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 75 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 76 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 77 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 78 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 79 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 80 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 81 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 82 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 83 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 84 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 85 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 86 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 87 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 88 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 89 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 90 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 91 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 92 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 93 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 94 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 95 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 96 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 97 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 98 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 99 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 100 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 101 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 102 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 103 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 104 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 105 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 106 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 107 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 108 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 109 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 110 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 111 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 112 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 113 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 114 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 115 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 116 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 117 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 118 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 119 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 120 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 121 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 122 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 123 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 124 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 125 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 126 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 127 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 128 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 129 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 130 | 2820644600 | Unclassified Firmicutes Cu122P5bin39 | Isolate | Unclassified |
| 131 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 132 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 133 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 134 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 135 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 136 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 137 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 138 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 139 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 140 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 141 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 142 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 143 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 144 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 145 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 146 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 147 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 148 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 149 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 150 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 151 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 152 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 153 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 154 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 155 | 2820516196 | Unclassified Firmicutes Lab288P1bin3 | Isolate | Unclassified |
| 156 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 157 | 2820406809 | Unclassified Firmicutes Lab288P4bin87 | Isolate | Unclassified |
| 158 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 159 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 160 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 161 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 162 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 163 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 164 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 165 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 166 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 167 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 168 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 169 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 170 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 171 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 172 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 173 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 174 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 175 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 176 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 177 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 178 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 179 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 180 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 181 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 182 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 183 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 184 | 2820734335 | Unclassified Chloroflexi Lab288P3bin99 | Isolate | Unclassified |
| 185 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 186 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 187 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 188 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 189 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 190 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 191 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 192 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 193 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 194 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 195 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 196 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 197 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0882 | 3300056842 | Unclassified | 39194 |
| 2 | JGI24698J34947_10000311 | 3300002449 | Bacteria | 21367 |
| 3 | JGI24698J34947_10005559 | 3300002449 | Unclassified | 6915 |
| 4 | JGI24698J34947_10011833 | 3300002449 | Unclassified | 4792 |
| 5 | JGI24698J34947_10034459 | 3300002449 | Bacteria | 2649 |
| 6 | JGI24700J35501_10930816 | 3300002508 | Bacteria | 25448 |
| 7 | JGI24700J35501_10930817 | 3300002508 | Bacteria | 25486 |
| 8 | CVPL010L_1001570 | 3300002932 | Bacteria | 3609 |
| 9 | Ga0072941_1002644 | 3300005201 | Bacteria | 83076 |
| 10 | Ga0123357_10153687 | 3300009784 | Bacteria | 2783 |
| 11 | Ga0123355_10004025 | 3300009826 | Bacteria | 21295 |
| 12 | Ga0123355_10088251 | 3300009826 | Bacteria | 4927 |
| 13 | Ga0123356_10047255 | 3300010049 | Bacteria | 4004 |
| 14 | Ga0123356_10122078 | 3300010049 | Bacteria | 2536 |
| 15 | Ga0123356_10154554 | 3300010049 | Bacteria | 2283 |
| 16 | Ga0123353_10005780 | 3300010167 | Bacteria | 16326 |
| 17 | Ga0123353_10086059 | 3300010167 | Bacteria | 5062 |
| 18 | Ga0123353_10121090 | 3300010167 | Bacteria | 4208 |
| 19 | Ga0123354_10023525 | 3300010882 | Bacteria | 9714 |
| 20 | Ga0123354_10046303 | 3300010882 | Bacteria | 6646 |
| 21 | Ga0123354_10118954 | 3300010882 | Bacteria | 3426 |
| 22 | Ga0123354_10129766 | 3300010882 | Bacteria | 3191 |
| 23 | Ga0466711_406868 | 3300042615 | Bacteria | 4072 |
| 24 | Ga0466715_146475 | 3300042616 | Bacteria | 8599 |
| 25 | Ga0466715_418785 | 3300042616 | Bacteria | 3278 |
| 26 | Ga0466726_037128 | 3300042619 | Bacteria | 7242 |
| 27 | Ga0415639_002705 | 3300038395 | Bacteria | 45823 |
| 28 | Ga0415639_185778 | 3300038395 | Bacteria | 2901 |
| 29 | Ga0466694_205019 | 3300042594 | Bacteria | 3232 |
| 30 | Ga0466734_160894 | 3300042623 | Bacteria | 1334 |
| 31 | Ga0466734_165511 | 3300042623 | Bacteria | 1189 |
| 32 | Ga0466730_024608 | 3300042625 | Unclassified | 6883 |
| 33 | Ga0466700_414066 | 3300042600 | Bacteria | 3209 |
| 34 | Ga0466707_106253 | 3300042601 | Bacteria | 108878 |
| 35 | Ga0466707_172858 | 3300042601 | Bacteria | 9195 |
| 36 | Ga0466707_233573 | 3300042601 | Unclassified | 2266 |
| 37 | Ga0466697_280414 | 3300042611 | Bacteria | 4429 |
| 38 | Ga0466733_101104 | 3300042659 | Bacteria | 1324 |
| 39 | Ga0530661_000258 | 3300056564 | Bacteria | 42354 |
| 40 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 41 | Ga0562379_0363 | 3300056790 | Bacteria | 104557 |
| 42 | Ga0562377_0063 | 3300056842 | Bacteria | 461046 |
| 43 | Ga0562375_0009 | 3300056856 | Bacteria | 1746158 |
| 44 | Ga0562375_0096 | 3300056856 | Bacteria | 273717 |
| 45 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 46 | JGI24695J34938_10069575 | 3300002450 | Unclassified | 1475 |
| 47 | JGI24703J35330_11746237 | 3300002501 | Bacteria | 5088 |
| 48 | Ga0105553_1088541 | 3300007767 | Unclassified | 3007 |
| 49 | Ga0123355_10038641 | 3300009826 | Bacteria | 7763 |
| 50 | Ga0123355_10395654 | 3300009826 | Bacteria | 1787 |
| 51 | Ga0123356_10016162 | 3300010049 | Bacteria | 7128 |
| 52 | Ga0123356_10018538 | 3300010049 | Unclassified | 6605 |
| 53 | Ga0123353_10074706 | 3300010167 | Bacteria | 5448 |
| 54 | Ga0123353_10804060 | 3300010167 | Bacteria | 1298 |
| 55 | Ga0123353_10959585 | 3300010167 | Bacteria | 1155 |
| 56 | Ga0466715_067285 | 3300042616 | Bacteria | 27295 |
| 57 | Ga0466715_547364 | 3300042616 | Bacteria | 11495 |
| 58 | Ga0466715_631008 | 3300042616 | Bacteria | 2889 |
| 59 | Ga0466726_485267 | 3300042619 | Bacteria | 1522 |
| 60 | Ga0415639_208694 | 3300038395 | Bacteria | 3844 |
| 61 | Ga0466656_324624 | 3300042550 | Bacteria | 1013 |
| 62 | Ga0466696_114898 | 3300042596 | Bacteria | 1488 |
| 63 | Ga0466734_019526 | 3300042623 | Bacteria | 2273 |
| 64 | Ga0466727_045726 | 3300042655 | Bacteria | 10597 |
| 65 | Ga0466701_051645 | 3300042598 | Bacteria | 1644 |
| 66 | Ga0466707_224672 | 3300042601 | Bacteria | 2261 |
| 67 | Ga0466722_086033 | 3300042609 | Bacteria | 2197 |
| 68 | Ga0530661_042219 | 3300056564 | Bacteria | 1326 |
| 69 | Ga0562379_0035 | 3300056790 | Bacteria | 679259 |
| 70 | Ga0562379_0073 | 3300056790 | Bacteria | 410385 |
| 71 | Ga0562379_0745 | 3300056790 | Bacteria | 54476 |
| 72 | Ga0562375_0005 | 3300056856 | Bacteria | 2472444 |
| 73 | 2227494095 | 2225789004 | Bacteria | 3997 |
| 74 | JGI24698J34947_10000892 | 3300002449 | Bacteria | 15123 |
| 75 | JGI24698J34947_10052395 | 3300002449 | Unclassified | 2048 |
| 76 | JGI24702J35022_10100723 | 3300002462 | Bacteria | 1581 |
| 77 | JGI24702J35022_10126241 | 3300002462 | Bacteria | 1417 |
| 78 | JGI24700J35501_10849990 | 3300002508 | Bacteria | 1966 |
| 79 | Ga0123355_10098550 | 3300009826 | Bacteria | 4610 |
| 80 | Ga0123356_10016974 | 3300010049 | Bacteria | 6934 |
| 81 | Ga0123353_10160117 | 3300010167 | Bacteria | 3585 |
| 82 | Ga0466718_020487 | 3300042617 | Bacteria | 1285 |
| 83 | Ga0456237_0003896 | 3300041968 | Bacteria | 2406 |
| 84 | Ga0466735_013597 | 3300042624 | Bacteria | 199947 |
| 85 | Ga0466703_038561 | 3300042636 | Bacteria | 1325 |
| 86 | Ga0466703_117476 | 3300042636 | Bacteria | 29454 |
| 87 | Ga0466707_065903 | 3300042601 | Bacteria | 3814 |
| 88 | Ga0466707_120204 | 3300042601 | Bacteria | 23436 |
| 89 | Ga0466697_192943 | 3300042611 | Bacteria | 2560 |
| 90 | Ga0562374_0568 | 3300057007 | Bacteria | 59172 |
| 91 | IMNBL1DRAFT_c0010389 | 3300000062 | Bacteria | 4464 |
| 92 | JGI24703J35330_11732838 | 3300002501 | Bacteria | 2815 |
| 93 | JGI24703J35330_11745445 | 3300002501 | Bacteria | 4593 |
| 94 | Ga0123356_10012351 | 3300010049 | Bacteria | 8292 |
| 95 | Ga0123356_10511735 | 3300010049 | Bacteria | 1358 |
| 96 | Ga0123353_10165298 | 3300010167 | Unclassified | 3518 |
| 97 | Ga0123353_10201478 | 3300010167 | Bacteria | 3131 |
| 98 | Ga0466712_221181 | 3300042614 | Bacteria | 28077 |
| 99 | Ga0466723_091070 | 3300042618 | Bacteria | 80773 |
| 100 | Ga0415639_043799 | 3300038395 | Bacteria | 8558 |
| 101 | Ga0466692_046574 | 3300042591 | Bacteria | 14818 |
| 102 | Ga0466692_191207 | 3300042591 | Unclassified | 7719 |
| 103 | Ga0466696_233238 | 3300042596 | Bacteria | 1556 |
| 104 | Ga0466727_265395 | 3300042655 | Bacteria | 1395 |
| 105 | Ga0466707_052901 | 3300042601 | Bacteria | 24964 |
| 106 | Ga0466707_233622 | 3300042601 | Bacteria | 11636 |
| 107 | Ga0466707_243590 | 3300042601 | Bacteria | 5607 |
| 108 | Ga0466713_059769 | 3300042602 | Bacteria | 172763 |
| 109 | Ga0466705_197008 | 3300042612 | Bacteria | 18545 |
| 110 | Ga0466705_364507 | 3300042612 | Bacteria | 1423 |
| 111 | Ga0562379_0231 | 3300056790 | Bacteria | 152000 |
| 112 | 2227090010 | 2225789004 | Bacteria | 1839 |
| 113 | 2227150830 | 2225789004 | Bacteria | 1588 |
| 114 | JGI24698J34947_10000844 | 3300002449 | Bacteria | 15391 |
| 115 | Ga0123357_10015989 | 3300009784 | Bacteria | 9857 |
| 116 | Ga0123357_10031484 | 3300009784 | Unclassified | 7196 |
| 117 | Ga0123355_10039985 | 3300009826 | Bacteria | 7633 |
| 118 | Ga0123355_10080377 | 3300009826 | Bacteria | 5205 |
| 119 | Ga0123356_10039591 | 3300010049 | Bacteria | 4391 |
| 120 | Ga0123353_10305520 | 3300010167 | Bacteria | 2425 |
| 121 | Ga0123353_10307384 | 3300010167 | Bacteria | 2416 |
| 122 | Ga0123353_10915876 | 3300010167 | Bacteria | 1191 |
| 123 | Ga0123354_10280901 | 3300010882 | Bacteria | 1617 |
| 124 | Ga0466712_072724 | 3300042614 | Unclassified | 6369 |
| 125 | Ga0466715_097016 | 3300042616 | Bacteria | 22103 |
| 126 | Ga0466694_222635 | 3300042594 | Unclassified | 1701 |
| 127 | Ga0466696_365644 | 3300042596 | Bacteria | 2105 |
| 128 | Ga0466734_161874 | 3300042623 | Bacteria | 2573 |
| 129 | Ga0466700_125904 | 3300042600 | Bacteria | 18922 |
| 130 | Ga0466707_083766 | 3300042601 | Bacteria | 14435 |
| 131 | Ga0466707_181727 | 3300042601 | Bacteria | 103366 |
| 132 | Ga0466707_359476 | 3300042601 | Bacteria | 5626 |
| 133 | Ga0466714_064292 | 3300042603 | Bacteria | 74164 |
| 134 | Ga0466719_155889 | 3300042606 | Bacteria | 6002 |
| 135 | Ga0562379_0864 | 3300056790 | Bacteria | 45677 |
| 136 | Ga0562377_0264 | 3300056842 | Bacteria | 116515 |
| 137 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 138 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 139 | Ga0072940_1099348 | 3300005200 | Bacteria | 7185 |
| 140 | Ga0123357_10035602 | 3300009784 | Bacteria | 6768 |
| 141 | Ga0123353_10129141 | 3300010167 | Bacteria | 4058 |
| 142 | Ga0123353_10926471 | 3300010167 | Bacteria | 1182 |
| 143 | Ga0123354_10143987 | 3300010882 | Bacteria | 2929 |
| 144 | Ga0466712_101966 | 3300042614 | Bacteria | 2957 |
| 145 | Ga0466726_252095 | 3300042619 | Bacteria | 6933 |
| 146 | Ga0466728_001147 | 3300042620 | Bacteria | 2698 |
| 147 | Ga0466696_312354 | 3300042596 | Bacteria | 4120 |
| 148 | Ga0466724_56909 | 3300042649 | Bacteria | 15742 |
| 149 | Ga0466707_344657 | 3300042601 | Bacteria | 6400 |
| 150 | Ga0466713_026803 | 3300042602 | Bacteria | 64874 |
| 151 | Ga0466719_045714 | 3300042606 | Bacteria | 2612 |
| 152 | Ga0466719_456299 | 3300042606 | Bacteria | 2333 |
| 153 | Ga0466722_246602 | 3300042609 | Bacteria | 12685 |
| 154 | Ga0466697_145326 | 3300042611 | Bacteria | 3536 |
| 155 | Ga0562375_0100 | 3300056856 | Bacteria | 265693 |
| 156 | Ga0562374_1386 | 3300057007 | Unclassified | 28696 |
| 157 | JGI24698J34947_10012730 | 3300002449 | Bacteria | 4606 |
| 158 | JGI24703J35330_11747588 | 3300002501 | Bacteria | 7396 |
| 159 | JGI24697J35500_11273298 | 3300002507 | Bacteria | 5525 |
| 160 | Ga0123357_10090522 | 3300009784 | Unclassified | 3990 |
| 161 | Ga0123355_10000621 | 3300009826 | Bacteria | 47975 |
| 162 | Ga0123355_10014213 | 3300009826 | Unclassified | 12435 |
| 163 | Ga0123355_10031758 | 3300009826 | Unclassified | 8568 |
| 164 | Ga0123353_10033378 | 3300010167 | Bacteria | 8014 |
| 165 | Ga0123353_10134245 | 3300010167 | Unclassified | 3970 |
| 166 | Ga0123353_10444674 | 3300010167 | Bacteria | 1911 |
| 167 | Ga0123353_10447995 | 3300010167 | Bacteria | 1902 |
| 168 | Ga0466715_226389 | 3300042616 | Bacteria | 29197 |
| 169 | Ga0466728_178759 | 3300042620 | Bacteria | 5871 |
| 170 | Ga0466692_131728 | 3300042591 | Bacteria | 45931 |
| 171 | Ga0466696_286602 | 3300042596 | Bacteria | 3571 |
| 172 | Ga0466729_316237 | 3300042621 | Bacteria | 22092 |
| 173 | Ga0466734_006750 | 3300042623 | Bacteria | 5095 |
| 174 | Ga0466704_004753 | 3300042643 | Bacteria | 14844 |
| 175 | Ga0466708_114903 | 3300042652 | Bacteria | 49445 |
| 176 | Ga0466707_318547 | 3300042601 | Bacteria | 2727 |
| 177 | Ga0466713_135694 | 3300042602 | Bacteria | 11679 |
| 178 | Ga0466717_055277 | 3300042604 | Bacteria | 1140 |
| 179 | Ga0466722_017663 | 3300042609 | Bacteria | 3937 |
| 180 | Ga0466722_060541 | 3300042609 | Bacteria | 3019 |
| 181 | Ga0466733_062564 | 3300042659 | Bacteria | 17813 |
| 182 | Ga0466733_120672 | 3300042659 | Bacteria | 26705 |
| 183 | Ga0562377_0019 | 3300056842 | Bacteria | 1067000 |
| 184 | JGI24696J40584_12959644 | 3300002834 | Bacteria | 5412 |
| 185 | Ga0072941_1059063 | 3300005201 | Bacteria | 39555 |
| 186 | Ga0123355_10045932 | 3300009826 | Unclassified | 7104 |
| 187 | Ga0123355_10138664 | 3300009826 | Bacteria | 3729 |
| 188 | Ga0123356_10013031 | 3300010049 | Bacteria | 8043 |
| 189 | Ga0123354_10177455 | 3300010882 | Bacteria | 2448 |
| 190 | Ga0466712_009968 | 3300042614 | Bacteria | 14444 |
| 191 | Ga0466712_113890 | 3300042614 | Bacteria | 23988 |
| 192 | Ga0466726_052608 | 3300042619 | Bacteria | 4820 |
| 193 | Ga0466693_194138 | 3300042592 | Bacteria | 3782 |
| 194 | Ga0466696_010017 | 3300042596 | Bacteria | 6157 |
| 195 | Ga0466735_192787 | 3300042624 | Bacteria | 4212 |
| 196 | Ga0466703_266629 | 3300042636 | Bacteria | 2184 |
| 197 | Ga0466704_128930 | 3300042643 | Bacteria | 11229 |
| 198 | Ga0466704_504111 | 3300042643 | Bacteria | 7744 |
| 199 | Ga0466708_295249 | 3300042652 | Bacteria | 14129 |
| 200 | Ga0466707_011603 | 3300042601 | Bacteria | 2904 |
| 201 | Ga0466707_154618 | 3300042601 | Bacteria | 8330 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.