Protein Family IF07817
Metagenome
Isolate
394
Members
97
Samples
348
Scaffolds
257.36
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_484716|Ga0466715_484716_6877_7776
- Length
- 299 aa
- Sequence
- MFEAKGEKTLGGAFVSFPCKKTFFHFLRLENPSFSSNFAVMKILILGAGNMGAWFVESLCLEHDVAVFDTDKRRLRYFFNTYRFVTFDQIAAFSPEMVINAVSLQNTVAAFNDILPYLPEECILSDITSVKNGLCRYYQQLGRRFVSTHPMFGPTFASLKELSAQNAVIISESDEEGKQFFRDFYGALRLNIHEYTFEEHDKTMAYALSVPFASTMVFAACMRHQEAPGTTFKKHLDIAQGLLSENDYLLSEVLLNPHTLPQIEKIQARLSGLTEMIREKDTQALHRFIKGLRENIEQK
Sample Types
Isolate
11.7%
Metagenome
88.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.0%
Termitidae
22.7%
Kalotermitidae
14.4%
Unclassified
13.4%
Rhinotermitidae
6.2%
Termopsidae
4.1%
Passalidae
2.1%
Hydrophilidae
2.1%
Hodotermitidae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
1
Bacteria
380
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 2 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 3 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 4 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 5 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 6 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 7 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 8 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 9 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 10 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 11 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 14 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 20 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 21 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 22 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 23 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 24 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 29 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 30 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 31 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 32 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 33 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 34 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 37 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 38 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 39 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 40 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 41 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 42 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 45 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 46 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 47 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 48 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 49 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 50 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 51 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 52 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 53 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 54 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 55 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 56 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 57 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 58 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 59 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 60 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 61 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 62 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 63 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 64 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 65 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 66 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 67 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 68 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 69 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 70 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 71 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 72 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 73 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 74 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 75 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 76 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 77 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 78 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 79 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 80 | 2819998259 | Unclassified Spirochaetes Nc150P4bin23 | Isolate | Unclassified |
| 81 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 82 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 83 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 84 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 85 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 86 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 87 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 88 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 89 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 90 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 91 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 92 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 93 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 94 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 95 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 96 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 97 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_238595 | 3300042611 | Bacteria | 3160 |
| 2 | Ga0466705_178912 | 3300042612 | Bacteria | 12543 |
| 3 | Ga0466727_352290 | 3300042655 | Bacteria | 4454 |
| 4 | Ga0466733_036662 | 3300042659 | Bacteria | 4856 |
| 5 | Ga0466733_080542 | 3300042659 | Bacteria | 2508 |
| 6 | Ga0466733_102731 | 3300042659 | Bacteria | 1677 |
| 7 | Ga0466733_137450 | 3300042659 | Bacteria | 18606 |
| 8 | Ga0466731_360293 | 3300042622 | Bacteria | 1684 |
| 9 | Ga0466703_207790 | 3300042636 | Bacteria | 3239 |
| 10 | Ga0466704_006676 | 3300042643 | Bacteria | 13973 |
| 11 | Ga0466704_379647 | 3300042643 | Bacteria | 5258 |
| 12 | Ga0466704_541758 | 3300042643 | Bacteria | 43707 |
| 13 | Ga0466709_038756 | 3300042648 | Bacteria | 10537 |
| 14 | Ga0466708_271976 | 3300042652 | Bacteria | 60941 |
| 15 | Ga0466727_194713 | 3300042655 | Bacteria | 3140 |
| 16 | Ga0123356_10008114 | 3300010049 | Bacteria | 10459 |
| 17 | Ga0123356_10021138 | 3300010049 | Bacteria | 6150 |
| 18 | Ga0123356_10378518 | 3300010049 | Bacteria | 1547 |
| 19 | Ga0123353_10146448 | 3300010167 | Bacteria | 3775 |
| 20 | Ga0123353_10299875 | 3300010167 | Bacteria | 2454 |
| 21 | Ga0123353_10424077 | 3300010167 | Bacteria | 1970 |
| 22 | Ga0123354_10008149 | 3300010882 | Bacteria | 15906 |
| 23 | Ga0123354_10082756 | 3300010882 | Bacteria | 4521 |
| 24 | Ga0466705_518155 | 3300042612 | Bacteria | 1148 |
| 25 | Ga0466710_124392 | 3300042613 | Bacteria | 1205 |
| 26 | Ga0466710_289327 | 3300042613 | Bacteria | 1646 |
| 27 | Ga0466715_044201 | 3300042616 | Bacteria | 21603 |
| 28 | Ga0466715_325706 | 3300042616 | Bacteria | 3768 |
| 29 | Ga0466715_484716 | 3300042616 | Bacteria | 8204 |
| 30 | Ga0466726_101923 | 3300042619 | Bacteria | 2658 |
| 31 | Ga0466729_044479 | 3300042621 | Bacteria | 12266 |
| 32 | Ga0466656_324024 | 3300042550 | Bacteria | 1069 |
| 33 | Ga0466690_131176 | 3300042590 | Bacteria | 21782 |
| 34 | Ga0466691_000698 | 3300042593 | Bacteria | 35058 |
| 35 | Ga0466691_081639 | 3300042593 | Bacteria | 33689 |
| 36 | Ga0466691_192357 | 3300042593 | Bacteria | 4377 |
| 37 | Ga0466696_278891 | 3300042596 | Bacteria | 171866 |
| 38 | Ga0466696_326849 | 3300042596 | Bacteria | 9736 |
| 39 | Ga0466696_385707 | 3300042596 | Bacteria | 4232 |
| 40 | Ga0466701_005522 | 3300042598 | Bacteria | 21003 |
| 41 | Ga0466700_081785 | 3300042600 | Bacteria | 2793 |
| 42 | Ga0466700_344792 | 3300042600 | Bacteria | 2512 |
| 43 | Ga0466707_179707 | 3300042601 | Bacteria | 18977 |
| 44 | Ga0466707_231351 | 3300042601 | Bacteria | 5713 |
| 45 | Ga0466707_241058 | 3300042601 | Bacteria | 3179 |
| 46 | Ga0466707_280552 | 3300042601 | Bacteria | 12628 |
| 47 | Ga0466713_042069 | 3300042602 | Bacteria | 4056 |
| 48 | Ga0466713_102313 | 3300042602 | Bacteria | 97036 |
| 49 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 50 | Ga0466722_023479 | 3300042609 | Bacteria | 103035 |
| 51 | JGI24702J35022_10000952 | 3300002462 | Bacteria | 18056 |
| 52 | JGI24702J35022_10095780 | 3300002462 | Bacteria | 1619 |
| 53 | JGI24702J35022_10165612 | 3300002462 | Unclassified | 1247 |
| 54 | JGI24699J35502_11133753 | 3300002509 | Bacteria | 14839 |
| 55 | Ga0466735_101743 | 3300042624 | Bacteria | 1754 |
| 56 | Ga0466735_153729 | 3300042624 | Unclassified | 1107 |
| 57 | Ga0466735_183525 | 3300042624 | Bacteria | 1818 |
| 58 | Ga0466703_275769 | 3300042636 | Bacteria | 24178 |
| 59 | Ga0466704_441958 | 3300042643 | Bacteria | 19981 |
| 60 | Ga0466709_065802 | 3300042648 | Bacteria | 4537 |
| 61 | Ga0466725_439507 | 3300042654 | Bacteria | 4065 |
| 62 | Ga0466727_238068 | 3300042655 | Bacteria | 1362 |
| 63 | Ga0123357_10020591 | 3300009784 | Bacteria | 8821 |
| 64 | Ga0123357_10037785 | 3300009784 | Bacteria | 6572 |
| 65 | Ga0123353_10000206 | 3300010167 | Bacteria | 74863 |
| 66 | Ga0123353_10032489 | 3300010167 | Bacteria | 8105 |
| 67 | Ga0123353_10090911 | 3300010167 | Bacteria | 4916 |
| 68 | Ga0123353_10456853 | 3300010167 | Bacteria | 1878 |
| 69 | Ga0123353_10578270 | 3300010167 | Bacteria | 1612 |
| 70 | Ga0123353_10628559 | 3300010167 | Bacteria | 1526 |
| 71 | Ga0123353_10786186 | 3300010167 | Unclassified | 1317 |
| 72 | Ga0123354_10175676 | 3300010882 | Bacteria | 2470 |
| 73 | Ga0123354_10276228 | 3300010882 | Bacteria | 1642 |
| 74 | Ga0466711_024998 | 3300042615 | Bacteria | 17622 |
| 75 | Ga0466715_037900 | 3300042616 | Bacteria | 143938 |
| 76 | Ga0466723_099232 | 3300042618 | Bacteria | 25745 |
| 77 | Ga0466723_284270 | 3300042618 | Bacteria | 5057 |
| 78 | Ga0466726_145705 | 3300042619 | Bacteria | 31377 |
| 79 | Ga0466726_205742 | 3300042619 | Bacteria | 2558 |
| 80 | Ga0466690_100585 | 3300042590 | Bacteria | 7056 |
| 81 | Ga0466690_169289 | 3300042590 | Bacteria | 1288 |
| 82 | Ga0466692_196455 | 3300042591 | Bacteria | 23185 |
| 83 | Ga0466700_441738 | 3300042600 | Bacteria | 12466 |
| 84 | Ga0466707_015339 | 3300042601 | Bacteria | 5164 |
| 85 | Ga0466713_077669 | 3300042602 | Bacteria | 61043 |
| 86 | Ga0466713_150088 | 3300042602 | Bacteria | 12359 |
| 87 | Ga0466716_475313 | 3300042605 | Bacteria | 12267 |
| 88 | Ga0466722_199756 | 3300042609 | Bacteria | 5076 |
| 89 | Ga0466722_236552 | 3300042609 | Bacteria | 22260 |
| 90 | 2227397471 | 2225789004 | Bacteria | 5810 |
| 91 | JGI24702J35022_10022137 | 3300002462 | Bacteria | 3444 |
| 92 | JGI24705J35276_12118426 | 3300002504 | Bacteria | 1065 |
| 93 | Ga0068305_10049092 | 3300005083 | Bacteria | 12491 |
| 94 | Ga0466705_074044 | 3300042612 | Bacteria | 12838 |
| 95 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 96 | Ga0466729_220593 | 3300042621 | Bacteria | 10715 |
| 97 | Ga0466734_076031 | 3300042623 | Bacteria | 1425 |
| 98 | Ga0466734_089355 | 3300042623 | Bacteria | 1386 |
| 99 | Ga0466735_040050 | 3300042624 | Bacteria | 8779 |
| 100 | Ga0466703_248121 | 3300042636 | Bacteria | 12446 |
| 101 | Ga0466703_354739 | 3300042636 | Bacteria | 14499 |
| 102 | Ga0466704_089736 | 3300042643 | Bacteria | 2619 |
| 103 | Ga0466704_485002 | 3300042643 | Bacteria | 2240 |
| 104 | Ga0466709_092384 | 3300042648 | Bacteria | 14108 |
| 105 | Ga0466708_373102 | 3300042652 | Bacteria | 35091 |
| 106 | Ga0123357_10130694 | 3300009784 | Bacteria | 3128 |
| 107 | Ga0123357_10299839 | 3300009784 | Bacteria | 1625 |
| 108 | Ga0123353_10994928 | 3300010167 | Bacteria | 1127 |
| 109 | Ga0123354_10003291 | 3300010882 | Bacteria | 22202 |
| 110 | Ga0123354_10014675 | 3300010882 | Bacteria | 12208 |
| 111 | Ga0466711_192972 | 3300042615 | Bacteria | 7435 |
| 112 | Ga0466715_225738 | 3300042616 | Bacteria | 51802 |
| 113 | Ga0466715_435339 | 3300042616 | Bacteria | 5276 |
| 114 | Ga0466723_039598 | 3300042618 | Bacteria | 14635 |
| 115 | Ga0466723_220522 | 3300042618 | Bacteria | 6169 |
| 116 | Ga0466726_468951 | 3300042619 | Bacteria | 1126 |
| 117 | Ga0466728_064337 | 3300042620 | Bacteria | 5441 |
| 118 | Ga0415639_199694 | 3300038395 | Bacteria | 1528 |
| 119 | Ga0466657_393637 | 3300042582 | Bacteria | 2247 |
| 120 | Ga0466691_059765 | 3300042593 | Bacteria | 33678 |
| 121 | Ga0466701_044687 | 3300042598 | Bacteria | 2517 |
| 122 | Ga0466701_098337 | 3300042598 | Unclassified | 1451 |
| 123 | Ga0466706_098182 | 3300042599 | Bacteria | 3180 |
| 124 | Ga0466700_172638 | 3300042600 | Bacteria | 5823 |
| 125 | Ga0466707_111106 | 3300042601 | Bacteria | 10236 |
| 126 | Ga0466707_183678 | 3300042601 | Bacteria | 8035 |
| 127 | Ga0466707_310754 | 3300042601 | Bacteria | 3869 |
| 128 | Ga0466713_139107 | 3300042602 | Bacteria | 3508 |
| 129 | Ga0466714_037253 | 3300042603 | Bacteria | 40676 |
| 130 | Ga0466714_150199 | 3300042603 | Bacteria | 149649 |
| 131 | Ga0466719_498298 | 3300042606 | Bacteria | 3083 |
| 132 | 2227157468 | 2225789004 | Bacteria | 1566 |
| 133 | JGI24705J35276_12238165 | 3300002504 | Bacteria | 16751 |
| 134 | Ga0068305_10075406 | 3300005083 | Bacteria | 8523 |
| 135 | Ga0466733_103622 | 3300042659 | Unclassified | 9938 |
| 136 | Ga0466733_192837 | 3300042659 | Bacteria | 23549 |
| 137 | Ga0466735_052130 | 3300042624 | Bacteria | 2411 |
| 138 | Ga0466735_174050 | 3300042624 | Bacteria | 4460 |
| 139 | Ga0466703_122371 | 3300042636 | Bacteria | 5922 |
| 140 | Ga0466703_302929 | 3300042636 | Bacteria | 8145 |
| 141 | Ga0466703_339730 | 3300042636 | Bacteria | 24723 |
| 142 | Ga0466704_083849 | 3300042643 | Bacteria | 13312 |
| 143 | Ga0466704_108837 | 3300042643 | Bacteria | 11314 |
| 144 | Ga0466704_124104 | 3300042643 | Bacteria | 5190 |
| 145 | Ga0466704_266808 | 3300042643 | Bacteria | 2289 |
| 146 | Ga0466709_378007 | 3300042648 | Bacteria | 5280 |
| 147 | Ga0466725_102832 | 3300042654 | Bacteria | 30734 |
| 148 | Ga0123356_10067148 | 3300010049 | Bacteria | 3359 |
| 149 | Ga0123353_10872906 | 3300010167 | Bacteria | 1229 |
| 150 | Ga0123354_10359939 | 3300010882 | Bacteria | 1284 |
| 151 | Ga0466711_290308 | 3300042615 | Bacteria | 7999 |
| 152 | Ga0466715_411803 | 3300042616 | Bacteria | 24002 |
| 153 | Ga0466726_295782 | 3300042619 | Bacteria | 1579 |
| 154 | Ga0466728_131950 | 3300042620 | Bacteria | 16045 |
| 155 | Ga0466690_028280 | 3300042590 | Bacteria | 10088 |
| 156 | Ga0466690_266080 | 3300042590 | Bacteria | 1939 |
| 157 | Ga0466693_343849 | 3300042592 | Bacteria | 1493 |
| 158 | Ga0466694_282250 | 3300042594 | Bacteria | 6832 |
| 159 | Ga0466696_066030 | 3300042596 | Bacteria | 5854 |
| 160 | Ga0466701_060265 | 3300042598 | Bacteria | 1871 |
| 161 | Ga0466701_098080 | 3300042598 | Bacteria | 65896 |
| 162 | Ga0466706_025174 | 3300042599 | Bacteria | 118676 |
| 163 | Ga0466707_152495 | 3300042601 | Bacteria | 8828 |
| 164 | Ga0466713_054978 | 3300042602 | Bacteria | 2083 |
| 165 | Ga0466713_057825 | 3300042602 | Bacteria | 8237 |
| 166 | Ga0466717_151254 | 3300042604 | Bacteria | 1407 |
| 167 | Ga0466716_043422 | 3300042605 | Bacteria | 9090 |
| 168 | Ga0466716_315505 | 3300042605 | Bacteria | 4246 |
| 169 | Ga0466716_487123 | 3300042605 | Bacteria | 6582 |
| 170 | Ga0466719_231609 | 3300042606 | Bacteria | 2142 |
| 171 | JGI24702J35022_10040882 | 3300002462 | Bacteria | 2473 |
| 172 | JGI24705J35276_12234677 | 3300002504 | Bacteria | 5729 |
| 173 | Ga0466697_248994 | 3300042611 | Bacteria | 2098 |
| 174 | Ga0466705_129997 | 3300042612 | Bacteria | 10626 |
| 175 | Ga0466705_264616 | 3300042612 | Unclassified | 8882 |
| 176 | Ga0466733_037650 | 3300042659 | Bacteria | 3449 |
| 177 | Ga0466733_056906 | 3300042659 | Bacteria | 4141 |
| 178 | Ga0466733_078852 | 3300042659 | Bacteria | 1225 |
| 179 | Ga0466733_090618 | 3300042659 | Bacteria | 1007 |
| 180 | Ga0466735_093465 | 3300042624 | Bacteria | 3532 |
| 181 | Ga0466735_229303 | 3300042624 | Bacteria | 1182 |
| 182 | Ga0466703_343665 | 3300042636 | Bacteria | 26612 |
| 183 | Ga0466704_006848 | 3300042643 | Bacteria | 2801 |
| 184 | Ga0466704_268493 | 3300042643 | Bacteria | 12380 |
| 185 | Ga0466727_023034 | 3300042655 | Bacteria | 15116 |
| 186 | Ga0466727_315517 | 3300042655 | Bacteria | 5499 |
| 187 | Ga0123356_10175256 | 3300010049 | Bacteria | 2160 |
| 188 | Ga0123353_10165313 | 3300010167 | Bacteria | 3518 |
| 189 | Ga0466710_399485 | 3300042613 | Bacteria | 5384 |
| 190 | Ga0466711_018054 | 3300042615 | Bacteria | 10147 |
| 191 | Ga0466715_087187 | 3300042616 | Bacteria | 23079 |
| 192 | Ga0466715_322586 | 3300042616 | Bacteria | 14107 |
| 193 | Ga0466715_389324 | 3300042616 | Bacteria | 1990 |
| 194 | Ga0466723_074687 | 3300042618 | Bacteria | 8034 |
| 195 | Ga0466723_330980 | 3300042618 | Bacteria | 2363 |
| 196 | Ga0466723_355099 | 3300042618 | Bacteria | 1537 |
| 197 | Ga0466726_289117 | 3300042619 | Bacteria | 17472 |
| 198 | Ga0466690_018709 | 3300042590 | Bacteria | 16629 |
| 199 | Ga0466692_094598 | 3300042591 | Bacteria | 21053 |
| 200 | Ga0466691_016402 | 3300042593 | Bacteria | 4991 |
| 201 | Ga0466691_018901 | 3300042593 | Bacteria | 17257 |
| 202 | Ga0466700_174611 | 3300042600 | Bacteria | 29560 |
| 203 | Ga0466707_171476 | 3300042601 | Bacteria | 8721 |
| 204 | Ga0466707_185424 | 3300042601 | Bacteria | 5319 |
| 205 | Ga0466717_311763 | 3300042604 | Bacteria | 4872 |
| 206 | Ga0466716_523018 | 3300042605 | Bacteria | 3690 |
| 207 | Ga0466719_320439 | 3300042606 | Bacteria | 1696 |
| 208 | Ga0466719_498398 | 3300042606 | Bacteria | 5972 |
| 209 | Ga0466722_212733 | 3300042609 | Bacteria | 11949 |
| 210 | 2227482984 | 2225789004 | Bacteria | 21557 |
| 211 | JGI24702J35022_10001907 | 3300002462 | Bacteria | 12835 |
| 212 | Ga0068302_10196627 | 3300005071 | Bacteria | 2691 |
| 213 | Ga0068305_10081315 | 3300005083 | Bacteria | 2981 |
| 214 | Ga0466705_060747 | 3300042612 | Bacteria | 8456 |
| 215 | Ga0466729_221857 | 3300042621 | Bacteria | 4265 |
| 216 | Ga0466703_137946 | 3300042636 | Bacteria | 9402 |
| 217 | Ga0466703_234734 | 3300042636 | Bacteria | 21309 |
| 218 | Ga0466703_325348 | 3300042636 | Bacteria | 18703 |
| 219 | Ga0466704_039292 | 3300042643 | Bacteria | 5272 |
| 220 | Ga0466704_195560 | 3300042643 | Bacteria | 4704 |
| 221 | Ga0466704_463873 | 3300042643 | Unclassified | 1606 |
| 222 | Ga0466708_125186 | 3300042652 | Bacteria | 10347 |
| 223 | Ga0466727_041976 | 3300042655 | Bacteria | 33578 |
| 224 | Ga0466727_141543 | 3300042655 | Bacteria | 1606 |
| 225 | Ga0123357_10017954 | 3300009784 | Unclassified | 9388 |
| 226 | Ga0123357_10055539 | 3300009784 | Bacteria | 5331 |
| 227 | Ga0123357_10065090 | 3300009784 | Unclassified | 4869 |
| 228 | Ga0123357_10262138 | 3300009784 | Bacteria | 1824 |
| 229 | Ga0123356_10804131 | 3300010049 | Bacteria | 1111 |
| 230 | Ga0123353_10789321 | 3300010167 | Bacteria | 1314 |
| 231 | Ga0123353_10819678 | 3300010167 | Bacteria | 1281 |
| 232 | Ga0123354_10006605 | 3300010882 | Bacteria | 17272 |
| 233 | Ga0466705_485986 | 3300042612 | Bacteria | 7687 |
| 234 | Ga0466723_028314 | 3300042618 | Bacteria | 10677 |
| 235 | Ga0466728_079520 | 3300042620 | Bacteria | 32961 |
| 236 | Ga0466728_115557 | 3300042620 | Bacteria | 8553 |
| 237 | Ga0466728_438150 | 3300042620 | Bacteria | 10836 |
| 238 | Ga0466656_292290 | 3300042550 | Bacteria | 2590 |
| 239 | Ga0466690_055481 | 3300042590 | Bacteria | 72316 |
| 240 | Ga0466690_090255 | 3300042590 | Unclassified | 3117 |
| 241 | Ga0466690_379940 | 3300042590 | Bacteria | 10035 |
| 242 | Ga0466692_101052 | 3300042591 | Bacteria | 5759 |
| 243 | Ga0466692_137050 | 3300042591 | Bacteria | 50701 |
| 244 | Ga0466692_141527 | 3300042591 | Bacteria | 1054 |
| 245 | Ga0466693_356573 | 3300042592 | Archaea | 2979 |
| 246 | Ga0466696_054708 | 3300042596 | Bacteria | 19377 |
| 247 | Ga0466696_395823 | 3300042596 | Bacteria | 1461 |
| 248 | Ga0466706_172332 | 3300042599 | Bacteria | 3750 |
| 249 | Ga0466707_124419 | 3300042601 | Bacteria | 18062 |
| 250 | Ga0466713_098675 | 3300042602 | Bacteria | 12369 |
| 251 | Ga0466713_115952 | 3300042602 | Bacteria | 49145 |
| 252 | Ga0466713_119500 | 3300042602 | Bacteria | 16007 |
| 253 | Ga0466714_013813 | 3300042603 | Bacteria | 151010 |
| 254 | Ga0466716_523209 | 3300042605 | Bacteria | 9336 |
| 255 | Ga0466719_381729 | 3300042606 | Bacteria | 15281 |
| 256 | 2227577405 | 2225789004 | Bacteria | 13536 |
| 257 | IMNBL1DRAFT_c0000891 | 3300000062 | Bacteria | 23227 |
| 258 | JGI24702J35022_10093971 | 3300002462 | Bacteria | 1635 |
| 259 | Ga0466697_105108 | 3300042611 | Bacteria | 94766 |
| 260 | Ga0466705_270858 | 3300042612 | Bacteria | 8495 |
| 261 | Ga0466733_084099 | 3300042659 | Bacteria | 17407 |
| 262 | Ga0466733_097718 | 3300042659 | Bacteria | 15472 |
| 263 | Ga0466733_170029 | 3300042659 | Bacteria | 24463 |
| 264 | Ga0466729_291305 | 3300042621 | Bacteria | 3334 |
| 265 | Ga0466731_071593 | 3300042622 | Bacteria | 3280 |
| 266 | Ga0466703_336636 | 3300042636 | Bacteria | 12804 |
| 267 | Ga0466703_352928 | 3300042636 | Bacteria | 1577 |
| 268 | Ga0466709_021217 | 3300042648 | Bacteria | 24774 |
| 269 | Ga0466709_356844 | 3300042648 | Bacteria | 2191 |
| 270 | Ga0466708_221865 | 3300042652 | Bacteria | 8654 |
| 271 | Ga0466708_379717 | 3300042652 | Bacteria | 21213 |
| 272 | Ga0466727_111230 | 3300042655 | Bacteria | 11259 |
| 273 | Ga0123353_10070699 | 3300010167 | Bacteria | 5608 |
| 274 | Ga0123353_10164597 | 3300010167 | Bacteria | 3527 |
| 275 | Ga0123354_10156155 | 3300010882 | Unclassified | 2736 |
| 276 | Ga0466710_444747 | 3300042613 | Bacteria | 1509 |
| 277 | Ga0466710_446023 | 3300042613 | Bacteria | 5675 |
| 278 | Ga0466711_228470 | 3300042615 | Bacteria | 16578 |
| 279 | Ga0466711_311542 | 3300042615 | Bacteria | 4234 |
| 280 | Ga0466711_342239 | 3300042615 | Unclassified | 3814 |
| 281 | Ga0466715_072498 | 3300042616 | Bacteria | 11998 |
| 282 | Ga0466715_157136 | 3300042616 | Bacteria | 21139 |
| 283 | Ga0466715_227089 | 3300042616 | Bacteria | 6850 |
| 284 | Ga0466723_011686 | 3300042618 | Bacteria | 37097 |
| 285 | Ga0466723_026766 | 3300042618 | Bacteria | 20254 |
| 286 | Ga0466723_253394 | 3300042618 | Bacteria | 13778 |
| 287 | Ga0466726_292542 | 3300042619 | Bacteria | 5356 |
| 288 | Ga0466690_009119 | 3300042590 | Bacteria | 57867 |
| 289 | Ga0466690_072887 | 3300042590 | Bacteria | 20329 |
| 290 | Ga0466690_116775 | 3300042590 | Bacteria | 3357 |
| 291 | Ga0466690_384415 | 3300042590 | Bacteria | 23452 |
| 292 | Ga0466693_451445 | 3300042592 | Bacteria | 2148 |
| 293 | Ga0466691_053951 | 3300042593 | Bacteria | 23010 |
| 294 | Ga0466691_169706 | 3300042593 | Bacteria | 4021 |
| 295 | Ga0466694_278517 | 3300042594 | Bacteria | 1511 |
| 296 | Ga0466696_005954 | 3300042596 | Bacteria | 2596 |
| 297 | Ga0466696_048166 | 3300042596 | Bacteria | 14077 |
| 298 | Ga0466696_096383 | 3300042596 | Bacteria | 10587 |
| 299 | Ga0466706_064728 | 3300042599 | Bacteria | 82048 |
| 300 | Ga0466713_021377 | 3300042602 | Bacteria | 32539 |
| 301 | Ga0466713_031005 | 3300042602 | Bacteria | 38195 |
| 302 | Ga0466714_124175 | 3300042603 | Bacteria | 3264 |
| 303 | Ga0466717_276695 | 3300042604 | Bacteria | 1438 |
| 304 | Ga0466716_080023 | 3300042605 | Bacteria | 6444 |
| 305 | Ga0466719_281613 | 3300042606 | Bacteria | 7571 |
| 306 | Ga0466719_354946 | 3300042606 | Bacteria | 1784 |
| 307 | Ga0466722_105988 | 3300042609 | Bacteria | 14092 |
| 308 | IMNBL1DRAFT_c0001425 | 3300000062 | Bacteria | 17893 |
| 309 | JGI24702J35022_10002996 | 3300002462 | Bacteria | 10224 |
| 310 | JGI24702J35022_10203293 | 3300002462 | Bacteria | 1135 |
| 311 | JGI24705J35276_12220361 | 3300002504 | Bacteria | 2262 |
| 312 | JGI24699J35502_11133981 | 3300002509 | Bacteria | 22510 |
| 313 | Ga0466705_020049 | 3300042612 | Bacteria | 4747 |
| 314 | Ga0466705_381971 | 3300042612 | Bacteria | 1104 |
| 315 | Ga0466729_215862 | 3300042621 | Bacteria | 1148 |
| 316 | Ga0466729_253590 | 3300042621 | Bacteria | 2087 |
| 317 | Ga0466735_072666 | 3300042624 | Bacteria | 2522 |
| 318 | Ga0466703_066112 | 3300042636 | Bacteria | 22062 |
| 319 | Ga0466704_045880 | 3300042643 | Bacteria | 5575 |
| 320 | Ga0123357_10011880 | 3300009784 | Bacteria | 11197 |
| 321 | Ga0123356_10059965 | 3300010049 | Bacteria | 3550 |
| 322 | Ga0123356_10599441 | 3300010049 | Bacteria | 1266 |
| 323 | Ga0123356_11011622 | 3300010049 | Bacteria | 1001 |
| 324 | Ga0123354_10165629 | 3300010882 | Bacteria | 2600 |
| 325 | Ga0466705_502511 | 3300042612 | Bacteria | 10409 |
| 326 | Ga0466711_184071 | 3300042615 | Bacteria | 34370 |
| 327 | Ga0466711_273097 | 3300042615 | Bacteria | 19131 |
| 328 | Ga0466715_077474 | 3300042616 | Bacteria | 16543 |
| 329 | Ga0466715_381340 | 3300042616 | Bacteria | 10212 |
| 330 | Ga0456237_0000007 | 3300041968 | Bacteria | 61435 |
| 331 | Ga0466657_340551 | 3300042582 | Bacteria | 6429 |
| 332 | Ga0466692_109685 | 3300042591 | Bacteria | 126606 |
| 333 | Ga0466691_200204 | 3300042593 | Bacteria | 12641 |
| 334 | Ga0466696_067727 | 3300042596 | Bacteria | 1222 |
| 335 | Ga0466706_266164 | 3300042599 | Bacteria | 3207 |
| 336 | Ga0466700_028383 | 3300042600 | Bacteria | 2867 |
| 337 | Ga0466700_177310 | 3300042600 | Bacteria | 6314 |
| 338 | Ga0466707_106797 | 3300042601 | Bacteria | 6402 |
| 339 | Ga0466716_112161 | 3300042605 | Bacteria | 19040 |
| 340 | Ga0466719_036135 | 3300042606 | Bacteria | 2407 |
| 341 | Ga0466719_062495 | 3300042606 | Bacteria | 4264 |
| 342 | 2227464934 | 2225789004 | Bacteria | 5215 |
| 343 | 2227616283 | 2225789004 | Bacteria | 11886 |
| 344 | IMNBL1DRAFT_c0002922 | 3300000062 | Bacteria | 11412 |
| 345 | IMNBL1DRAFT_c0013966 | 3300000062 | Bacteria | 3571 |
| 346 | JGI24702J35022_10042889 | 3300002462 | Unclassified | 2408 |
| 347 | JGI24702J35022_10096531 | 3300002462 | Bacteria | 1614 |
| 348 | Ga0123357_10002550 | 3300009784 | Bacteria | 20413 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02153 | PDH_N | Prephenate dehydrogenase, nucleotide-binding domain | 96 | 183 | 0.89 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02153 | GO:0070403 | NAD+ binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.