Protein Family IF07762
Metagenome
Isolate
179
Members
61
Samples
169
Scaffolds
248.23
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_329305|Ga0466715_329305_1502_2290
- Length
- 262 aa
- Sequence
- MRLRLRENKKDKIMSNLLKGKTAIITGAARGIGKAVAKRFAEEGCNIAFTDLAIDDNARATEAELAAKGVKVKAYASNAANFDDTHKVVENIVADFSRIDILVNNAGITRDGLMLRMTELQWDAVLTVNLKSAFNFIHAVSPVMMRQKSGSIINMSSVVGVHGNAGQANYSASKAGMIGLAKSIAQELGSRGIRANAIAPGFIVTEMTHQLSDDVREEWIKRIPLRRGGTPEDVADVALFLASDLSSYITGQVIQIDGGMNT
Sample Types
Isolate
5.6%
Metagenome
94.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.0%
Kalotermitidae
23.0%
Unclassified
13.1%
Rhinotermitidae
8.2%
Termopsidae
6.6%
Passalidae
3.3%
Blattidae
3.3%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
171
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 11 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 23 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2820455747 | Unclassified Firmicutes Lab288P3bin160 | Isolate | Unclassified |
| 33 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 39 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 40 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 41 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 42 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 43 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 44 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 45 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 46 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 2593339124 | Clostridium sp. 4 | Isolate | Termitidae |
| 52 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 59 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 60 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10257990 | 3300009784 | Bacteria | 1849 |
| 2 | Ga0123355_10529735 | 3300009826 | Bacteria | 1436 |
| 3 | Ga0123356_10012807 | 3300010049 | Bacteria | 8120 |
| 4 | Ga0123353_10003150 | 3300010167 | Bacteria | 20728 |
| 5 | Ga0123354_10002953 | 3300010882 | Bacteria | 23087 |
| 6 | Ga0466711_245991 | 3300042615 | Bacteria | 8257 |
| 7 | 2227563833 | 2225789004 | Bacteria | 2692 |
| 8 | IMNBL1DRAFT_c0000013 | 3300000062 | Bacteria | 180832 |
| 9 | JGI24699J35502_10973680 | 3300002509 | Bacteria | 1245 |
| 10 | Ga0466705_369079 | 3300042612 | Bacteria | 2817 |
| 11 | Ga0466735_079356 | 3300042624 | Bacteria | 8146 |
| 12 | Ga0415639_029890 | 3300038395 | Bacteria | 33874 |
| 13 | Ga0466692_030175 | 3300042591 | Bacteria | 39678 |
| 14 | Ga0466692_037895 | 3300042591 | Bacteria | 20664 |
| 15 | Ga0466706_005003 | 3300042599 | Bacteria | 88622 |
| 16 | Ga0466706_049528 | 3300042599 | Bacteria | 126627 |
| 17 | Ga0466700_405432 | 3300042600 | Bacteria | 27797 |
| 18 | Ga0466707_042066 | 3300042601 | Bacteria | 33916 |
| 19 | Ga0466707_119850 | 3300042601 | Bacteria | 1699 |
| 20 | Ga0466713_024846 | 3300042602 | Unclassified | 1875 |
| 21 | Ga0466716_251109 | 3300042605 | Bacteria | 15660 |
| 22 | Ga0466719_132659 | 3300042606 | Bacteria | 30972 |
| 23 | Ga0123356_11223099 | 3300010049 | Unclassified | 917 |
| 24 | Ga0123354_10211254 | 3300010882 | Unclassified | 2096 |
| 25 | Ga0466710_098942 | 3300042613 | Bacteria | 1921 |
| 26 | Ga0466715_329305 | 3300042616 | Bacteria | 8640 |
| 27 | Ga0466715_348253 | 3300042616 | Bacteria | 12317 |
| 28 | Ga0466723_249141 | 3300042618 | Bacteria | 8106 |
| 29 | Ga0466728_424661 | 3300042620 | Bacteria | 2849 |
| 30 | 2227522695 | 2225789004 | Bacteria | 3309 |
| 31 | IMNBL1DRAFT_c0001623 | 3300000062 | Bacteria | 16669 |
| 32 | JGI24695J34938_10072498 | 3300002450 | Bacteria | 1436 |
| 33 | JGI24699J35502_11132371 | 3300002509 | Bacteria | 6759 |
| 34 | JGI24699J35502_11132388 | 3300002509 | Bacteria | 6784 |
| 35 | Ga0466705_078007 | 3300042612 | Bacteria | 7058 |
| 36 | Ga0466704_432001 | 3300042643 | Bacteria | 2388 |
| 37 | Ga0466727_095823 | 3300042655 | Bacteria | 11264 |
| 38 | Ga0466732_028661 | 3300042656 | Bacteria | 90899 |
| 39 | Ga0466692_121438 | 3300042591 | Bacteria | 29354 |
| 40 | Ga0466696_048279 | 3300042596 | Bacteria | 9304 |
| 41 | Ga0466706_135756 | 3300042599 | Bacteria | 21184 |
| 42 | Ga0466713_093796 | 3300042602 | Bacteria | 2481 |
| 43 | Ga0466713_121173 | 3300042602 | Bacteria | 12626 |
| 44 | Ga0466713_149150 | 3300042602 | Bacteria | 2205 |
| 45 | Ga0466714_093285 | 3300042603 | Bacteria | 105352 |
| 46 | Ga0123357_10237058 | 3300009784 | Bacteria | 1985 |
| 47 | Ga0123353_10195207 | 3300010167 | Bacteria | 3191 |
| 48 | Ga0466715_080209 | 3300042616 | Bacteria | 5381 |
| 49 | Ga0466715_583205 | 3300042616 | Bacteria | 24186 |
| 50 | Ga0466729_191822 | 3300042621 | Unclassified | 3034 |
| 51 | IMNBL1DRAFT_c0002769 | 3300000062 | Bacteria | 11906 |
| 52 | JGI24705J35276_12217212 | 3300002504 | Bacteria | 2082 |
| 53 | Ga0123357_10001032 | 3300009784 | Bacteria | 28568 |
| 54 | Ga0466735_024490 | 3300042624 | Bacteria | 16233 |
| 55 | Ga0466703_122037 | 3300042636 | Bacteria | 17789 |
| 56 | Ga0466704_108937 | 3300042643 | Bacteria | 1822 |
| 57 | Ga0466704_330089 | 3300042643 | Bacteria | 6145 |
| 58 | Ga0466709_008379 | 3300042648 | Bacteria | 52460 |
| 59 | Ga0466727_032376 | 3300042655 | Bacteria | 52244 |
| 60 | Ga0466690_048858 | 3300042590 | Bacteria | 42701 |
| 61 | Ga0466694_106298 | 3300042594 | Bacteria | 2765 |
| 62 | Ga0466706_016366 | 3300042599 | Bacteria | 4531 |
| 63 | Ga0466700_368886 | 3300042600 | Bacteria | 4757 |
| 64 | Ga0466713_073953 | 3300042602 | Bacteria | 19632 |
| 65 | Ga0466713_098854 | 3300042602 | Bacteria | 24287 |
| 66 | Ga0466722_029409 | 3300042609 | Bacteria | 2760 |
| 67 | Ga0466722_051599 | 3300042609 | Bacteria | 1042 |
| 68 | Ga0466697_002249 | 3300042611 | Bacteria | 1886 |
| 69 | Ga0123356_10509829 | 3300010049 | Bacteria | 1360 |
| 70 | Ga0123353_10375635 | 3300010167 | Bacteria | 2129 |
| 71 | Ga0466726_142521 | 3300042619 | Bacteria | 18957 |
| 72 | IMNBL1DRAFT_c0014572 | 3300000062 | Bacteria | 3461 |
| 73 | JGI24702J35022_10003201 | 3300002462 | Bacteria | 9902 |
| 74 | JGI24703J35330_11521429 | 3300002501 | Bacteria | 1159 |
| 75 | Ga0466735_130405 | 3300042624 | Bacteria | 4502 |
| 76 | Ga0466708_020647 | 3300042652 | Bacteria | 6190 |
| 77 | Ga0466727_271032 | 3300042655 | Bacteria | 1768 |
| 78 | Ga0466706_179674 | 3300042599 | Bacteria | 17495 |
| 79 | Ga0466706_282332 | 3300042599 | Bacteria | 32021 |
| 80 | Ga0466713_132462 | 3300042602 | Bacteria | 4687 |
| 81 | Ga0466713_139014 | 3300042602 | Bacteria | 1201 |
| 82 | Ga0123357_10052147 | 3300009784 | Bacteria | 5525 |
| 83 | Ga0123357_10307417 | 3300009784 | Unclassified | 1589 |
| 84 | Ga0123355_10158019 | 3300009826 | Bacteria | 3424 |
| 85 | Ga0466723_005723 | 3300042618 | Bacteria | 7983 |
| 86 | Ga0466726_363155 | 3300042619 | Bacteria | 1451 |
| 87 | Ga0466728_360258 | 3300042620 | Bacteria | 5803 |
| 88 | Ga0466729_300903 | 3300042621 | Bacteria | 2584 |
| 89 | Ga0466735_121841 | 3300042624 | Bacteria | 5081 |
| 90 | Ga0466735_167842 | 3300042624 | Bacteria | 3642 |
| 91 | Ga0466703_018083 | 3300042636 | Bacteria | 4847 |
| 92 | Ga0466703_379112 | 3300042636 | Bacteria | 1645 |
| 93 | Ga0466704_172555 | 3300042643 | Bacteria | 11829 |
| 94 | Ga0466690_000525 | 3300042590 | Bacteria | 32328 |
| 95 | Ga0466692_073426 | 3300042591 | Bacteria | 43614 |
| 96 | Ga0466691_222548 | 3300042593 | Bacteria | 20111 |
| 97 | Ga0466696_480041 | 3300042596 | Bacteria | 1289 |
| 98 | Ga0466707_087386 | 3300042601 | Bacteria | 25499 |
| 99 | Ga0466707_145942 | 3300042601 | Bacteria | 2180 |
| 100 | Ga0466707_261326 | 3300042601 | Bacteria | 4883 |
| 101 | Ga0466713_109180 | 3300042602 | Bacteria | 24782 |
| 102 | Ga0123356_10165033 | 3300010049 | Bacteria | 2218 |
| 103 | Ga0123354_10020792 | 3300010882 | Bacteria | 10331 |
| 104 | Ga0123354_10044892 | 3300010882 | Bacteria | 6770 |
| 105 | Ga0466711_187829 | 3300042615 | Bacteria | 15956 |
| 106 | Ga0466729_016365 | 3300042621 | Bacteria | 6989 |
| 107 | 2227228038 | 2225789004 | Bacteria | 7376 |
| 108 | JGI24702J35022_10038259 | 3300002462 | Bacteria | 2561 |
| 109 | Ga0068302_10060375 | 3300005071 | Bacteria | 4678 |
| 110 | Ga0068305_10009828 | 3300005083 | Bacteria | 82865 |
| 111 | Ga0068305_10023303 | 3300005083 | Bacteria | 7787 |
| 112 | Ga0466697_156793 | 3300042611 | Bacteria | 4723 |
| 113 | Ga0466735_099042 | 3300042624 | Bacteria | 1181 |
| 114 | Ga0466735_156494 | 3300042624 | Bacteria | 2300 |
| 115 | Ga0466703_150695 | 3300042636 | Bacteria | 7729 |
| 116 | Ga0466703_282611 | 3300042636 | Unclassified | 6819 |
| 117 | Ga0456237_0000006 | 3300041968 | Bacteria | 62306 |
| 118 | Ga0466692_040197 | 3300042591 | Bacteria | 1081 |
| 119 | Ga0466696_313177 | 3300042596 | Bacteria | 11374 |
| 120 | Ga0466699_082287 | 3300042597 | Bacteria | 1486 |
| 121 | Ga0466706_040982 | 3300042599 | Bacteria | 2363 |
| 122 | Ga0466706_140997 | 3300042599 | Bacteria | 4928 |
| 123 | Ga0466706_173154 | 3300042599 | Bacteria | 26903 |
| 124 | Ga0466700_039627 | 3300042600 | Bacteria | 11016 |
| 125 | Ga0466700_230751 | 3300042600 | Bacteria | 4063 |
| 126 | Ga0466707_240784 | 3300042601 | Bacteria | 2167 |
| 127 | Ga0466707_284882 | 3300042601 | Bacteria | 17288 |
| 128 | Ga0466713_023577 | 3300042602 | Bacteria | 2659 |
| 129 | Ga0466714_011114 | 3300042603 | Bacteria | 1213 |
| 130 | Ga0466714_132550 | 3300042603 | Bacteria | 1191 |
| 131 | Ga0466719_189881 | 3300042606 | Bacteria | 5922 |
| 132 | Ga0466719_484878 | 3300042606 | Bacteria | 7887 |
| 133 | Ga0466722_118575 | 3300042609 | Unclassified | 3522 |
| 134 | Ga0123354_10431973 | 3300010882 | Unclassified | 1084 |
| 135 | Ga0466715_405663 | 3300042616 | Bacteria | 18925 |
| 136 | 2227563503 | 2225789004 | Bacteria | 52747 |
| 137 | JGI24699J35502_11133974 | 3300002509 | Bacteria | 22272 |
| 138 | Ga0466734_014218 | 3300042623 | Bacteria | 2206 |
| 139 | Ga0466703_122933 | 3300042636 | Bacteria | 9570 |
| 140 | Ga0466709_154165 | 3300042648 | Bacteria | 14931 |
| 141 | Ga0466727_335323 | 3300042655 | Bacteria | 2434 |
| 142 | Ga0466657_371113 | 3300042582 | Bacteria | 4158 |
| 143 | Ga0466690_139871 | 3300042590 | Bacteria | 13005 |
| 144 | Ga0466690_156773 | 3300042590 | Bacteria | 3990 |
| 145 | Ga0466692_151269 | 3300042591 | Bacteria | 10165 |
| 146 | Ga0466706_010424 | 3300042599 | Bacteria | 17050 |
| 147 | Ga0466713_086638 | 3300042602 | Bacteria | 6169 |
| 148 | Ga0466717_096429 | 3300042604 | Bacteria | 1184 |
| 149 | Ga0466716_268235 | 3300042605 | Bacteria | 3655 |
| 150 | Ga0466719_252377 | 3300042606 | Bacteria | 6432 |
| 151 | Ga0466722_007565 | 3300042609 | Bacteria | 18233 |
| 152 | Ga0466722_129498 | 3300042609 | Bacteria | 2625 |
| 153 | Ga0466722_166973 | 3300042609 | Bacteria | 14816 |
| 154 | Ga0466722_175484 | 3300042609 | Bacteria | 16031 |
| 155 | Ga0123357_10257312 | 3300009784 | Bacteria | 1853 |
| 156 | Ga0123354_10000925 | 3300010882 | Bacteria | 32969 |
| 157 | Ga0123354_10018220 | 3300010882 | Bacteria | 11007 |
| 158 | Ga0466711_011990 | 3300042615 | Bacteria | 6742 |
| 159 | Ga0466726_295959 | 3300042619 | Bacteria | 9043 |
| 160 | IMNBL1DRAFT_c0007451 | 3300000062 | Bacteria | 5753 |
| 161 | Ga0072940_1478540 | 3300005200 | Bacteria | 1548 |
| 162 | Ga0466735_067367 | 3300042624 | Bacteria | 8282 |
| 163 | Ga0466704_362206 | 3300042643 | Bacteria | 17907 |
| 164 | Ga0466690_222711 | 3300042590 | Bacteria | 7609 |
| 165 | Ga0466693_148422 | 3300042592 | Bacteria | 1673 |
| 166 | Ga0466707_072578 | 3300042601 | Bacteria | 15033 |
| 167 | Ga0466707_149735 | 3300042601 | Bacteria | 8086 |
| 168 | Ga0466707_325589 | 3300042601 | Bacteria | 6968 |
| 169 | Ga0466707_362455 | 3300042601 | Bacteria | 3607 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.